Align acetolactate synthase (subunit 1/2) (EC 2.2.1.6) (characterized)
to candidate Ga0059261_0067 Ga0059261_0067 acetolactate synthase, small subunit (EC 2.2.1.6)
Query= BRENDA::P00894 (163 letters) >FitnessBrowser__Korea:Ga0059261_0067 Length = 171 Score = 133 bits (334), Expect = 2e-36 Identities = 72/159 (45%), Positives = 109/159 (68%), Gaps = 3/159 (1%) Query: 2 RRILSVLLENESGALSRVIGLFSQRGYNIESLTVAP-TDDPTLSRMTIQTVGDEKVLEQI 60 R L+V+++NE G L+R+ GLF+ RGYNIESLTV+ T+D +SR+TI T LEQI Sbjct: 10 RHTLAVIVDNEPGILARIAGLFTARGYNIESLTVSEITEDKAVSRITIVTSASPATLEQI 69 Query: 61 EKQLHKLVDVLRVSEL-GQGAHVEREIMLVKIQASGYGRDEVKRNTEIFRGQIIDVTPSL 119 QL +LV V +V +L +G HVERE+ LVK+ +G R E R +E++R +++D T S Sbjct: 70 VAQLDRLVPVHKVHDLTAEGEHVERELALVKVAGTGDHRIEALRLSEVYRARVVDATISS 129 Query: 120 YTVQLAGTSGKLDAFLASIRDVAKIVEVARSGVVGLSRG 158 + ++ GT+ K+D F+ + +V ++EVAR+G+V +SRG Sbjct: 130 FVFEVTGTTEKIDKFIELMGEVG-LIEVARTGIVAISRG 167 Lambda K H 0.318 0.136 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 87 Number of extensions: 4 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 171 Length adjustment: 18 Effective length of query: 145 Effective length of database: 153 Effective search space: 22185 Effective search space used: 22185 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)
Align candidate Ga0059261_0067 Ga0059261_0067 (acetolactate synthase, small subunit (EC 2.2.1.6))
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.13271.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.13271.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.