GapMind for Amino acid biosynthesis

 

Aligments for a candidate for ilvD in Sphingomonas koreensis DSMZ 15582

Align dihydroxy-acid dehydratase (EC 4.2.1.9) (characterized)
to candidate Ga0059261_4216 Ga0059261_4216 Dihydroxyacid dehydratase/phosphogluconate dehydratase

Query= BRENDA::Q97UB2
         (558 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_4216 Ga0059261_4216
           Dihydroxyacid dehydratase/phosphogluconate dehydratase
          Length = 573

 Score =  509 bits (1311), Expect = e-148
 Identities = 264/557 (47%), Positives = 362/557 (64%), Gaps = 5/557 (0%)

Query: 4   KLNSPSRYHGI--YNAPHRAFLRSVGLTDEEIGKPLVAIATAWSEAGPCNFHTLALARVA 61
           K   PSR+  +    APHR++  ++G+++EEI +P VA+A+A +++ PCN    A A  A
Sbjct: 7   KSRLPSRHVSVGPERAPHRSYYYAMGISEEEIARPFVALASAGNDSAPCNTTLDAQADAA 66

Query: 62  KEGTKEAGLSPLAFPTMVVNDNIGMGSEGMRYSLVSRDLIADMVEAQFNAHAFDGLVGIG 121
           ++G  + G  P  F T+ V D I MG +GM+ SLVSR++IAD VE     H +D LVG  
Sbjct: 67  RKGVADNGGLPRRFNTITVTDGIAMGHQGMKSSLVSREVIADSVELSVRGHCYDALVGFA 126

Query: 122 GCDKTTPGILMAMARLNVPSIYIYGGSAEPGYFMGKRLTIEDVHEAIGAYLAKRITENEL 181
           GCDK+ PG++MAM RLN+PSI++YGGS  PG +  + +T+ DV E +G + A     +E+
Sbjct: 127 GCDKSLPGMMMAMLRLNIPSIFVYGGSILPGRYQDRDVTVVDVFEVVGKFAAGTCPISEV 186

Query: 182 YEIEKRAHPTLGTCSGLFTANTMGSMSEALGMALPGSASPTATSSRRVMYVKETGKALGS 241
           + +EK A P  G C G +TANTM  + EA+G++LP S    A  + R       G  +  
Sbjct: 187 HALEKVACPGHGACGGQYTANTMACVGEAIGLSLPNSNMVPAPYTSREQIAVAAGYQVME 246

Query: 242 LIENGIKSREILTFEAFENAITTLMAMGGSTNAVLHLLAIAYEAGVKLTLDDFNRISKRT 301
           L+E  I+ R+I T EAF NA   + A GGSTN  LHL A+A EAG+   L D   + K T
Sbjct: 247 LLERNIRPRDICTREAFINAARIVAATGGSTNGALHLPAMASEAGIDFDLFDVAEVFKST 306

Query: 302 PYIASMKPGGDYVMADLDEVGGVPVVLKKLLDAGLLHGDVLTVTGKTMKQNLEQYKYPNV 361
           PY A +KPGG YV  D+ E GGV +++K +L+ GLL+GD +TVTGKT+ +N++Q  +   
Sbjct: 307 PYAADLKPGGKYVAKDMYEAGGVYMLMKSMLENGLLYGDCMTVTGKTLGENIDQVTWN-- 364

Query: 362 PHSHIVRDVKNPIKPRGGIVILKGSLAPEGAVIKVAATNVVKFEGKAKVYNSEDDAFKGV 421
           P   ++ DV+ PI P GG+V L+G+LAP GA++KVA  + + FEG A+ ++ E+DAF  V
Sbjct: 365 PDQKVIYDVRTPITPTGGVVGLRGTLAPNGAIVKVAGMSRLVFEGPARCFDCEEDAFAAV 424

Query: 422 QSGEVSEGEVVIIRYEGPKGAPGMPEMLRVTAAIMGAGL-NNVALVTDGRFSGATRGPMV 480
           +  E+ EGEVV+IRYEGPKG PGM EML  TAA+ G G+   VAL+TDGRFSGATRG  +
Sbjct: 425 EKREIREGEVVVIRYEGPKGGPGMREMLSTTAALYGLGMGEKVALITDGRFSGATRGFCI 484

Query: 481 GHVAPEAMVGGPIAIVEDGDTIVIDVESERLDLKLSEEEIKNRLKRWSPPSPRYKSGLLA 540
           GHV PEA   GPIA+VEDGDTI ID E+  +DL ++E+ +  R  RW P    Y+SG L 
Sbjct: 485 GHVGPEAAECGPIALVEDGDTIRIDAEAGTIDLHVAEDVLAERRARWQPRENAYQSGALW 544

Query: 541 KYASLVSQASMGAVTRP 557
           +YA  V  A  GAVT P
Sbjct: 545 RYAQNVGPAYKGAVTHP 561


Lambda     K      H
   0.316    0.134    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 852
Number of extensions: 34
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 558
Length of database: 573
Length adjustment: 36
Effective length of query: 522
Effective length of database: 537
Effective search space:   280314
Effective search space used:   280314
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)

Align candidate Ga0059261_4216 Ga0059261_4216 (Dihydroxyacid dehydratase/phosphogluconate dehydratase)
to HMM TIGR00110 (ilvD: dihydroxy-acid dehydratase (EC 4.2.1.9))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00110.hmm
# target sequence database:        /tmp/gapView.15504.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00110  [M=543]
Accession:   TIGR00110
Description: ilvD: dihydroxy-acid dehydratase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
   5.2e-204  664.7   0.6     6e-204  664.5   0.6    1.0  1  lcl|FitnessBrowser__Korea:Ga0059261_4216  Ga0059261_4216 Dihydroxyacid deh


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Korea:Ga0059261_4216  Ga0059261_4216 Dihydroxyacid dehydratase/phosphogluconate dehydratase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  664.5   0.6    6e-204    6e-204       1     541 [.      23     559 ..      23     561 .. 0.99

  Alignments for each domain:
  == domain 1  score: 664.5 bits;  conditional E-value: 6e-204
                                 TIGR00110   1 aarallkatGlkdedlekPiiavvnsyteivPghvhlkdlaklvkeeieaaGgvakefntiavsDGiam 69 
                                               ++r+ ++a+G+++e++ +P++a++++ ++ +P++ +l+  a+++++++ ++Gg + +fnti+v+DGiam
  lcl|FitnessBrowser__Korea:Ga0059261_4216  23 PHRSYYYAMGISEEEIARPFVALASAGNDSAPCNTTLDAQADAARKGVADNGGLPRRFNTITVTDGIAM 91 
                                               689****************************************************************** PP

                                 TIGR00110  70 gheGmkysLpsreiiaDsvetvvkahalDalvvissCDkivPGmlmaalrlniPaivvsGGpmeagktk 138
                                               gh+Gmk sL+sre+iaDsve  v++h++Dalv  + CDk +PGm+ma+lrlniP+i+v+GG++ +g+++
  lcl|FitnessBrowser__Korea:Ga0059261_4216  92 GHQGMKSSLVSREVIADSVELSVRGHCYDALVGFAGCDKSLPGMMMAMLRLNIPSIFVYGGSILPGRYQ 160
                                               ********************************************************************* PP

                                 TIGR00110 139 lsekidlvdvfeavgeyaagklseeeleeiersacPtagsCsGlftansmacltealGlslPgsstlla 207
                                                 +++++vdvfe vg+ aag    +e++++e++acP+ g+C+G +tan+mac+ ea+GlslP+s  ++a
  lcl|FitnessBrowser__Korea:Ga0059261_4216 161 -DRDVTVVDVFEVVGKFAAGTCPISEVHALEKVACPGHGACGGQYTANTMACVGEAIGLSLPNSNMVPA 228
                                               .8******************************************************************* PP

                                 TIGR00110 208 tsaekkelakksgkrivelvkknikPrdiltkeafenaitldlalGGstntvLhllaiakeagvklsld 276
                                                 + ++++a  +g +++el+++ni+Prdi t+eaf na  ++ a+GGstn  Lhl+a+a+eag++++l 
  lcl|FitnessBrowser__Korea:Ga0059261_4216 229 PYTSREQIAVAAGYQVMELLERNIRPRDICTREAFINAARIVAATGGSTNGALHLPAMASEAGIDFDLF 297
                                               ********************************************************************* PP

                                 TIGR00110 277 dfdrlsrkvPllaklkPsgkkviedlhraGGvsavlkeldkegllhkdaltvtGktlaetlekvkvlrv 345
                                               d+ ++ + +P  a+lkP+gk+v +d+ +aGGv +++k++ ++gll  d++tvtGktl+e++++v+ +  
  lcl|FitnessBrowser__Korea:Ga0059261_4216 298 DVAEVFKSTPYAADLKPGGKYVAKDMYEAGGVYMLMKSMLENGLLYGDCMTVTGKTLGENIDQVTWN-P 365
                                               *****************************************************************99.8 PP

                                 TIGR00110 346 dqdvirsldnpvkkegglavLkGnlaeeGavvkiagveedilkfeGpakvfeseeealeailggkvkeG 414
                                               dq+vi  +  p++ +gg+  L+G la++Ga+vk+ag++   l+feGpa+ f+ ee+a +a+ +++++eG
  lcl|FitnessBrowser__Korea:Ga0059261_4216 366 DQKVIYDVRTPITPTGGVVGLRGTLAPNGAIVKVAGMSR--LVFEGPARCFDCEEDAFAAVEKREIREG 432
                                               9*************************************9..9*************************** PP

                                 TIGR00110 415 dvvviryeGPkGgPGmremLaPtsalvglGLgkkvaLitDGrfsGgtrGlsiGhvsPeaaegGaialve 483
                                               +vvviryeGPkGgPGmremL  t+al glG+g+kvaLitDGrfsG+trG++iGhv Peaae G+ialve
  lcl|FitnessBrowser__Korea:Ga0059261_4216 433 EVVVIRYEGPKGGPGMREMLSTTAALYGLGMGEKVALITDGRFSGATRGFCIGHVGPEAAECGPIALVE 501
                                               ********************************************************************* PP

                                 TIGR00110 484 dGDkikiDienrkldlevseeelaerrakakkkearevkgaLakyaklvssadkGavl 541
                                               dGD+i+iD+e+ ++dl+v e+ laerra+++++e+ +++gaL +ya+ v  a kGav+
  lcl|FitnessBrowser__Korea:Ga0059261_4216 502 DGDTIRIDAEAGTIDLHVAEDVLAERRARWQPRENAYQSGALWRYAQNVGPAYKGAVT 559
                                               ********************************************************97 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (543 nodes)
Target sequences:                          1  (573 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 10.86
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory