Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate Ga0059261_0213 Ga0059261_0213 4-hydroxy-tetrahydrodipicolinate synthase
Query= BRENDA::Q8UGL3 (294 letters) >FitnessBrowser__Korea:Ga0059261_0213 Length = 293 Score = 293 bits (749), Expect = 4e-84 Identities = 159/295 (53%), Positives = 205/295 (69%), Gaps = 4/295 (1%) Query: 1 MFKGSIPALITPFTDNGSVDEKAFAAHVEWQIAEGSNGLVPVGTTGESPTLSHDEHKRVV 60 MF GSIPALITPF NG E F VEWQIAEGS+ LVPVGTTGE+ TL+ DEH VV Sbjct: 1 MFTGSIPALITPFR-NGDFAEDVFRDFVEWQIAEGSSALVPVGTTGEAATLAKDEHFEVV 59 Query: 61 ELCIEVAAKRVPVIAGAGSNNTDEAIELALHAQEAGADALLVVTPYYNKPTQKGLFAHFS 120 +C++ R+PVIAG GSN+T AI A++AGADA+L+V PYYN+P+Q+G+F HF Sbjct: 60 RVCVDQVRGRIPVIAGTGSNDTRVAIGNVKAAKDAGADAVLMVPPYYNRPSQEGIFRHFE 119 Query: 121 AVAEAVKLPIVIYNIPPRSVVDMSPETMGALVKAHK-NIIGVKDATGKLDRVSEQRISCG 179 AVA +LPIV+YN+P R+V D+ PET+ +V+A + +KDATG L RVS R + Sbjct: 120 AVAAECELPIVLYNVPGRTVTDIQPETVIRIVQAFPGKFVAIKDATGDLARVSMHRAALR 179 Query: 180 KDFVQLSGEDGTALGFNAHGGVGCISVTANVAPRLCSEFQAAMLAGDYAKALEYQDRLMP 239 F QLSG D TAL FNA GGVGCISVTANVAP+LC++FQAA G+ A AL DRL Sbjct: 180 AGFAQLSGNDDTALAFNAMGGVGCISVTANVAPKLCAQFQAAWAEGNTALALALHDRLFA 239 Query: 240 LHRAIFMEPGVCGTKYALSKTRGG-NRRVRSPLMSTLEPATEAAIDAALKHAGLM 293 LH A+F + KYA++K R + +R P++ E A++AA+DAA++ AG++ Sbjct: 240 LHNAMFTDASPGPVKYAVNKLRPEISAELRLPMVEPGE-ASKAAVDAAMQAAGII 293 Lambda K H 0.317 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 288 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 293 Length adjustment: 26 Effective length of query: 268 Effective length of database: 267 Effective search space: 71556 Effective search space used: 71556 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate Ga0059261_0213 Ga0059261_0213 (4-hydroxy-tetrahydrodipicolinate synthase)
to HMM TIGR00674 (dapA: 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00674.hmm # target sequence database: /tmp/gapView.21119.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00674 [M=286] Accession: TIGR00674 Description: dapA: 4-hydroxy-tetrahydrodipicolinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-95 303.6 0.0 5.4e-95 303.5 0.0 1.0 1 lcl|FitnessBrowser__Korea:Ga0059261_0213 Ga0059261_0213 4-hydroxy-tetrahy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_0213 Ga0059261_0213 4-hydroxy-tetrahydrodipicolinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 303.5 0.0 5.4e-95 5.4e-95 1 284 [. 4 288 .. 4 290 .. 0.98 Alignments for each domain: == domain 1 score: 303.5 bits; conditional E-value: 5.4e-95 TIGR00674 1 gvltAliTPfkedgsvdfaalekliesqiekgvdaivvvGtTGEsatLsleEkkkvievavelvknrvp 69 g+++AliTPf++ +++ +e qi++g++a+v+vGtTGE+atL+++E+ +v++v v+ v++r+p lcl|FitnessBrowser__Korea:Ga0059261_0213 4 GSIPALITPFRNGD-FAEDVFRDFVEWQIAEGSSALVPVGTTGEAATLAKDEHFEVVRVCVDQVRGRIP 71 589*******9877.99**************************************************** PP TIGR00674 70 viaGtgsnateeaieltkeaeklgvdgvlvvtPyYnkPtqeGlykhfkaiaeevelPiilYnvPsRtgv 138 viaGtgsn t+ ai +k a+++g+d+vl+v PyYn+P+qeG+++hf+a+a+e+elPi+lYnvP+Rt++ lcl|FitnessBrowser__Korea:Ga0059261_0213 72 VIAGTGSNDTRVAIGNVKAAKDAGADAVLMVPPYYNRPSQEGIFRHFEAVAAECELPIVLYNVPGRTVT 140 ********************************************************************* PP TIGR00674 139 slepetvkrLaeeve..ivaiKeasgdlervseikaeakedfkvlsGdDaltleilalGakGviSVasn 205 +++petv+r+++ + +vaiK+a+gdl+rvs +a + f+ lsG+D ++l++ a+G+ G iSV++n lcl|FitnessBrowser__Korea:Ga0059261_0213 141 DIQPETVIRIVQAFPgkFVAIKDATGDLARVSMHRAALRAGFAQLSGNDDTALAFNAMGGVGCISVTAN 209 ***********998778**************************************************** PP TIGR00674 206 vapkelkemvkaalegdteeareihqkllklfkalfietNPipvKtalallgliekdelRlPLtelsee 274 vapk+++++ +a++eg+t+ a+ +h +l+ l++a+f+++ P pvK+a++ l ++elRlP++e e lcl|FitnessBrowser__Korea:Ga0059261_0213 210 VAPKLCAQFQAAWAEGNTALALALHDRLFALHNAMFTDASPGPVKYAVNKLRPEISAELRLPMVEPGEA 278 ***************************************************999999**********99 PP TIGR00674 275 kkeklkevlk 284 +k ++++++ lcl|FitnessBrowser__Korea:Ga0059261_0213 279 SKAAVDAAMQ 288 9999988776 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (286 nodes) Target sequences: 1 (293 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 6.81 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory