Align 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8) (characterized)
to candidate Ga0059261_2545 Ga0059261_2545 dihydrodipicolinate reductase (EC 1.3.1.26)
Query= BRENDA::Q2YJN7 (268 letters) >FitnessBrowser__Korea:Ga0059261_2545 Length = 242 Score = 221 bits (563), Expect = 1e-62 Identities = 133/262 (50%), Positives = 165/262 (62%), Gaps = 25/262 (9%) Query: 5 VVGAGGRMGQTLIRTIQSIEGAKLVGAIERSGSPFLGKDAGEVTGIGTLGVAITDDPLPV 64 + G+ GRMG IR I + +G K G G DAG DDP + Sbjct: 6 IYGSLGRMG-VAIRDILAEQGVKFAG----------GADAG-------------DDPAVL 41 Query: 65 FAKAHGVLDFTSPAASVEFAGLAAQARIVHVIGTTGCSAEDDEKIRAAARHATIVKSGNM 124 A A ++DF++PAA A A VIGTTG +A+ I AAR ++++GN Sbjct: 42 AAAADALVDFSTPAALESHLAAARAAGTPIVIGTTGLTAQHHALIDDAAREIAVLQTGNT 101 Query: 125 SLGVNLLSVLVQKAAEALGPEDFDIEILEMHHRHKVDAPSGTALLLGEAAARGRDIALAD 184 SLGV LL+ LV++AA LGP D+DIEI EMHHR KVDAPSGTAL+LGEAAA GR ++L + Sbjct: 102 SLGVVLLARLVREAATRLGP-DWDIEIAEMHHRQKVDAPSGTALMLGEAAAAGRAVSLGE 160 Query: 185 NSVRVRDGYTGPRETGAIGFATLRGGSVIGDHSVILAGTGERVVLSHHAEDRSIFARGAI 244 V R G TG R G IGFA+LRGG+VIGDH V+LAG GER+ L+H AEDR+IFARGA+ Sbjct: 161 VRVADRAGLTGARAEGTIGFASLRGGTVIGDHLVVLAGAGERIELAHRAEDRAIFARGAV 220 Query: 245 KAALWAHGKKPGLYSMLDVLGL 266 +AALW K G Y+M VLGL Sbjct: 221 RAALWLADKPAGRYTMDAVLGL 242 Lambda K H 0.318 0.136 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 242 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 242 Length adjustment: 24 Effective length of query: 244 Effective length of database: 218 Effective search space: 53192 Effective search space used: 53192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate Ga0059261_2545 Ga0059261_2545 (dihydrodipicolinate reductase (EC 1.3.1.26))
to HMM TIGR00036 (dapB: 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00036.hmm # target sequence database: /tmp/gapView.30909.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00036 [M=270] Accession: TIGR00036 Description: dapB: 4-hydroxy-tetrahydrodipicolinate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.9e-67 211.6 2.5 2.7e-65 206.5 0.2 2.0 2 lcl|FitnessBrowser__Korea:Ga0059261_2545 Ga0059261_2545 dihydrodipicolina Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_2545 Ga0059261_2545 dihydrodipicolinate reductase (EC 1.3.1.26) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 5.8 0.2 0.00046 0.00046 4 34 .. 4 33 .. 1 40 [. 0.82 2 ! 206.5 0.2 2.7e-65 2.7e-65 70 270 .] 42 241 .. 32 241 .. 0.97 Alignments for each domain: == domain 1 score: 5.8 bits; conditional E-value: 0.00046 TIGR00036 4 vavaGaaGrmGrevikavkeaedlelvaale 34 ++++G+ GrmG +i+ + ++++++ ++ + lcl|FitnessBrowser__Korea:Ga0059261_2545 4 IGIYGSLGRMGV-AIRDILAEQGVKFAGGAD 33 89*********7.579999999999887665 PP == domain 2 score: 206.5 bits; conditional E-value: 2.7e-65 TIGR00036 70 ekkadvliDfttpeavlenvkialekgvrlVvGTTGfseedlkelkdlaekkgvalviapNfaiGvnll 138 +ad l+Df+tp a +++++a ++g +V+GTTG++ ++ + + d+a + +a++ + N ++Gv+ll lcl|FitnessBrowser__Korea:Ga0059261_2545 42 AAAADALVDFSTPAALESHLAAARAAGTPIVIGTTGLTAQHHALIDDAARE--IAVLQTGNTSLGVVLL 108 5689***********************************************..**************** PP TIGR00036 139 lkllekaakvle.dvDiEiiElHHrhKkDaPSGTAlklaeiiakargkdlkeaaveeregltGerkkee 206 +l+++aa l+ d+DiEi E+HHr+K+DaPSGTAl l+e+ a+ r l e+ v r gltG+r + + lcl|FitnessBrowser__Korea:Ga0059261_2545 109 ARLVREAATRLGpDWDIEIAEMHHRQKVDAPSGTALMLGEAAAAGRAVSLGEVRVADRAGLTGARAEGT 177 **********97699****************************************************** PP TIGR00036 207 iGiaavRggdvvgehtvlFasdGerleitHkassRaafakGvvrairwledkeekvydledvld 270 iG+a++Rgg v+g+h v+ a+ Ger+e+ H+a +Ra+fa+G+vra+ wl+dk ++ y+++ vl+ lcl|FitnessBrowser__Korea:Ga0059261_2545 178 IGFASLRGGTVIGDHLVVLAGAGERIELAHRAEDRAIFARGAVRAALWLADKPAGRYTMDAVLG 241 ************************************************************9996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (242 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.03 # Mc/sec: 1.91 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory