Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate Ga0059261_2265 Ga0059261_2265 phosphoserine aminotransferase apoenzyme (EC 2.6.1.52)
Query= BRENDA::P52878 (370 letters) >FitnessBrowser__Korea:Ga0059261_2265 Length = 378 Score = 456 bits (1174), Expect = e-133 Identities = 219/369 (59%), Positives = 269/369 (72%), Gaps = 2/369 (0%) Query: 3 PTRVPNNPCFSSGPCAKHPGYSIEELKDTPFGRSHRSNLGKEKLAEAIKKTRDMLGLPDD 62 P P P FSSGPCAK PG+S ++L GRSHRS LGK +L AI R+ML LPD Sbjct: 8 PATKPARPYFSSGPCAKPPGWSADKLHTEVLGRSHRSKLGKTRLQYAIDLMREMLKLPDT 67 Query: 63 YLVGIVPASDTGAFEMCLWSMLGCRGVDVLVWESFSKGWATDITKQLKLKDVRVFEAEYG 122 + +GIVP SDTGAFEM +W+MLG RGV L WESF +GW TD KQLKL D V A+YG Sbjct: 68 HRIGIVPGSDTGAFEMAMWTMLGARGVTTLAWESFGEGWVTDAVKQLKL-DPTVIRADYG 126 Query: 123 KLPDLKKVDFKNDVVFVWNGTTSGVKVPNGDWIPENREGLTLCDATSAIFAMDIPYHKLD 182 +LPDL +VDF +DV+F WNGTTSGV+VPNGDWIP++REGLT D+TSA+FA D+P+ K+D Sbjct: 127 QLPDLSQVDFADDVLFTWNGTTSGVRVPNGDWIPDDREGLTFADSTSAVFAYDLPWDKID 186 Query: 183 VITFSWQKVLGGEGAHGMLILSPRAVQRLESYTPAWPLPKIFRLTKGGKLNKKIFEGSTI 242 V TFSWQKVLGGEG HG+LIL PRAV+RLE YTPAWPLPK+FRL GKL + +F+G TI Sbjct: 187 VATFSWQKVLGGEGGHGVLILGPRAVERLEQYTPAWPLPKVFRLMAKGKLAEGVFKGETI 246 Query: 243 NTPSMLANEDWLATLKWAESVGGLKPLIQRTNDNLAVFEAFVAKNNWIHFLAETKEIRSS 302 NTPSMLA ED + L+WA+ +GGL LI R++ N A + VA+ +W+ LA + RS Sbjct: 247 NTPSMLAVEDAIFALEWAKGLGGLDGLIARSDANAAALDKIVAERDWLGHLAADEATRSK 306 Query: 303 TSVCFKVDLSDEK-LKELIKTLEKEKVAYDIGSYRDAPSGLRIWCGATVEKEDLQCLCEW 361 TSVC V+ +DE +K LEK AYD+ YRDAP+GLRIWCGATV+ D++ L W Sbjct: 307 TSVCLTVEGADEAFIKTFASLLEKADAAYDVAGYRDAPAGLRIWCGATVDTADIEALGPW 366 Query: 362 IEWAYNLVK 370 ++WAY K Sbjct: 367 LDWAYASAK 375 Lambda K H 0.318 0.136 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 489 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 378 Length adjustment: 30 Effective length of query: 340 Effective length of database: 348 Effective search space: 118320 Effective search space used: 118320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate Ga0059261_2265 Ga0059261_2265 (phosphoserine aminotransferase apoenzyme (EC 2.6.1.52))
to HMM TIGR01365 (phosphoserine aminotransferase (EC 2.6.1.52))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01365.hmm # target sequence database: /tmp/gapView.15017.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01365 [M=374] Accession: TIGR01365 Description: serC_2: phosphoserine aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9e-183 593.5 0.5 1e-182 593.2 0.5 1.0 1 lcl|FitnessBrowser__Korea:Ga0059261_2265 Ga0059261_2265 phosphoserine ami Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_2265 Ga0059261_2265 phosphoserine aminotransferase apoenzyme (EC 2.6.1.52) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 593.2 0.5 1e-182 1e-182 1 373 [. 11 373 .. 11 374 .. 0.98 Alignments for each domain: == domain 1 score: 593.2 bits; conditional E-value: 1e-182 TIGR01365 1 rpanpefssgpcakrpgysveelknaalgrshrsklgkeklkeaiektrevlevpadyligivaasdtg 69 +pa+p fssgpcak pg+s ++l+ +lgrshrsklgk++l+ ai+ re+l++p+ ++igiv++sdtg lcl|FitnessBrowser__Korea:Ga0059261_2265 11 KPARPYFSSGPCAKPPGWSADKLHTEVLGRSHRSKLGKTRLQYAIDLMREMLKLPDTHRIGIVPGSDTG 79 69******************************************************************* PP TIGR01365 70 avemalwsllgargvdllafesfgkgwvtdvtkqlklkdvrvleaeygklpdlkkvdfkkdvvftwngt 138 a+ema+w++lgargv la+esfg+gwvtd +kqlkl d v+ a+yg+lpdl++vdf+ dv+ftwngt lcl|FitnessBrowser__Korea:Ga0059261_2265 80 AFEMAMWTMLGARGVTTLAWESFGEGWVTDAVKQLKL-DPTVIRADYGQLPDLSQVDFADDVLFTWNGT 147 ************************************9.6789*************************** PP TIGR01365 139 tsgvrvpngdfipadreglticdatsaafaqdldyekldvvtfswqkvlggegahgvlilspravarle 207 tsgvrvpngd+ip+dreglt+ d+tsa+fa dl+++k+dv tfswqkvlggeg hgvlil prav+rle lcl|FitnessBrowser__Korea:Ga0059261_2265 148 TSGVRVPNGDWIPDDREGLTFADSTSAVFAYDLPWDKIDVATFSWQKVLGGEGGHGVLILGPRAVERLE 216 ********************************************************************* PP TIGR01365 208 sytpawplpkifrltkggklskdifegetintpsmlavedaldalkwaesigglkalvaraddnlavle 276 ytpawplpk+frl gkl++++f+getintpsmlaveda+ al+wa+ +ggl+ l+ar+d+n+a l+ lcl|FitnessBrowser__Korea:Ga0059261_2265 217 QYTPAWPLPKVFRLMAKGKLAEGVFKGETINTPSMLAVEDAIFALEWAKGLGGLDGLIARSDANAAALD 285 ********************************************************************* PP TIGR01365 277 afvaksswvdflaatkeirsntsvclkvvdpdvaaldedaqadfakelvsalekegvaydigsyrdapa 345 + va +w+++laa +++rs+tsvcl v e a+ f+k ++s+lek ++ayd+ +yrdapa lcl|FitnessBrowser__Korea:Ga0059261_2265 286 KIVAERDWLGHLAADEATRSKTSVCLTV---------EGADEAFIKTFASLLEKADAAYDVAGYRDAPA 345 ***************************9.........444456************************** PP TIGR01365 346 glriwcgatveksdleallewldwafal 373 glriwcgatv++ d+eal +wldwa+a lcl|FitnessBrowser__Korea:Ga0059261_2265 346 GLRIWCGATVDTADIEALGPWLDWAYAS 373 **************************85 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (374 nodes) Target sequences: 1 (378 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.93 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory