GapMind for Amino acid biosynthesis

 

Aligments for a candidate for lysA in Sphingomonas koreensis DSMZ 15582

Align Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 (uncharacterized)
to candidate Ga0059261_2051 Ga0059261_2051 diaminopimelate decarboxylase

Query= curated2:Q9Z661
         (421 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_2051 Ga0059261_2051
           diaminopimelate decarboxylase
          Length = 419

 Score =  425 bits (1092), Expect = e-123
 Identities = 220/418 (52%), Positives = 290/418 (69%), Gaps = 3/418 (0%)

Query: 4   FSLKNGTLCVEDIPLPEIAAQYGTPCYVYSHSYLTERARRFTKALDGAGKGKSLVAFAVK 63
           F+ KNG L  E++ +P IAA+ GTP YVYS + L   A     AL  AG     +AFA+K
Sbjct: 4   FNRKNGVLHAENVSIPAIAAEVGTPVYVYSTATLERHASALKNAL--AGLPSVHLAFAIK 61

Query: 64  ANPSQAILASFAKEGLGADVVSAGEIRRAVHAGIPPERIVFSGVGKTAEEMRYALEIGIG 123
           ANP+ A+L   A++G GADVVS GE++RA+ AG+P E +VFSGVGKT  E++  L+ GIG
Sbjct: 62  ANPNLAVLGVLARQGYGADVVSGGELKRALAAGMPAEDVVFSGVGKTRAELQLGLDEGIG 121

Query: 124 QFNIESVSEIEMLAEVATSLGKKAAVALRINPDVDPHTHAKIATGKADTKFGIAAEDALS 183
           QFN+E   E E+LA++A + GK A   LR+NPDVD  THAKI+TGKA+ KFG+A + AL 
Sbjct: 122 QFNLELEEEGEVLADLAHAQGKTAPAVLRVNPDVDAGTHAKISTGKAENKFGVAIDRALE 181

Query: 184 AYEKLASYPSLKIQGIASHIGSQITDLAPFEAAAERIYEIITALEKAGHAIETADLGGGL 243
            +++LA  P L ++G+A HIGSQ+T+LAP EAA +R+ E++  L  AGH I   DLGGGL
Sbjct: 182 IFDRLAKRPGLNLRGVAIHIGSQLTELAPLEAAYKRVGELVAQLRAAGHTITHVDLGGGL 241

Query: 244 GVRYKDDQPEPPSVEAYGEMIKRVTKGWNCRLIFEPGRSLIANAGVLLSKVIRIKESKTA 303
           GV Y   Q    + E +G M+ RVT+GWN  L+FEPGR +  NAGVL+++VI +K +   
Sbjct: 242 GVPYHAGQ-TVSTAEEFGAMVARVTQGWNVTLMFEPGRFICGNAGVLVTEVIWVKPAAGN 300

Query: 304 RFVILDAAMNDLVRPTLYDAYHEIKAVTPSAQTYQADIVGPVCETGDIFARNRSISAVKA 363
            +VI+DAAMNDL RP LYDAYHE +AV P+ + + A+I GPVCETGD FA  R I  VK+
Sbjct: 301 PYVIVDAAMNDLARPALYDAYHEFEAVEPTGEKFVANIAGPVCETGDTFAMGREIDVVKS 360

Query: 364 DDLMAIMSAGAYGATMASAYNSRPLVAEVMVSGNKSALIRKRQSVEDLMRDEQKVEWL 421
            DL    +AGAYGATMAS YNSR LV EV+VSG++ A++  R   E +M  E+  EW+
Sbjct: 361 GDLAVFRTAGAYGATMASTYNSRALVPEVLVSGDRFAVVADRIQPETIMGAERVPEWV 418


Lambda     K      H
   0.317    0.132    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 480
Number of extensions: 16
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 421
Length of database: 419
Length adjustment: 32
Effective length of query: 389
Effective length of database: 387
Effective search space:   150543
Effective search space used:   150543
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)

Align candidate Ga0059261_2051 Ga0059261_2051 (diaminopimelate decarboxylase)
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01048.hmm
# target sequence database:        /tmp/gapView.2213.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01048  [M=417]
Accession:   TIGR01048
Description: lysA: diaminopimelate decarboxylase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
   2.9e-132  427.0   0.0   3.3e-132  426.9   0.0    1.0  1  lcl|FitnessBrowser__Korea:Ga0059261_2051  Ga0059261_2051 diaminopimelate d


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Korea:Ga0059261_2051  Ga0059261_2051 diaminopimelate decarboxylase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  426.9   0.0  3.3e-132  3.3e-132       4     414 ..       6     410 ..       3     413 .. 0.96

  Alignments for each domain:
  == domain 1  score: 426.9 bits;  conditional E-value: 3.3e-132
                                 TIGR01048   4 kkdgeleiegvdlkelaeefgtPlYvydeetlrerlealkeafkaees.lvlYAvKAnsnlavlrllae 71 
                                               +k+g l +e+v++ ++a+e gtP+Yvy+++tl+++++alk+a ++  s  +++A+KAn nlavl +la+
  lcl|FitnessBrowser__Korea:Ga0059261_2051   6 RKNGVLHAENVSIPAIAAEVGTPVYVYSTATLERHASALKNALAGLPSvHLAFAIKANPNLAVLGVLAR 74 
                                               68999***************************************966669******************* PP

                                 TIGR01048  72 eGlgldvvsgGEleralaAgvkaekivfsgngkseeeleaaleleiklinvdsveelelleeiakelgk 140
                                               +G g+dvvsgGEl+ralaAg++ae++vfsg+gk+++el+  l+ +i  +n++ +ee e l ++a+ +gk
  lcl|FitnessBrowser__Korea:Ga0059261_2051  75 QGYGADVVSGGELKRALAAGMPAEDVVFSGVGKTRAELQLGLDEGIGQFNLELEEEGEVLADLAHAQGK 143
                                               ********************************************************************* PP

                                 TIGR01048 141 karvllRvnpdvdaktheyisTGlkesKFGieveeaeeayelalkleslelvGihvHIGSqildlepfv 209
                                               +a+ +lRvnpdvda th +isTG++e+KFG+++++a+e++ + +k++ l+l G+ +HIGSq+++l+p++
  lcl|FitnessBrowser__Korea:Ga0059261_2051 144 TAPAVLRVNPDVDAGTHAKISTGKAENKFGVAIDRALEIFDRLAKRPGLNLRGVAIHIGSQLTELAPLE 212
                                               ********************************************************************* PP

                                 TIGR01048 210 eaaekvvklleelkeegieleeldlGGGlgisyeeeeeapdleeyaeklleklekeaelglklklilEp 278
                                               +a ++v +l+++l+++g +++++dlGGGlg++y+  ++  ++ee+  ++++++++    g +++l++Ep
  lcl|FitnessBrowser__Korea:Ga0059261_2051 213 AAYKRVGELVAQLRAAGHTITHVDLGGGLGVPYHAGQTVSTAEEFG-AMVARVTQ----GWNVTLMFEP 276
                                               ************************************9666666655.55556666....79******** PP

                                 TIGR01048 279 GRslvanagvlltrVesvKevesrkfvlvDagmndliRpalYeayheiaalkrleeeetetvdvvGplC 347
                                               GR++ +nagvl+t+V  vK +    +v+vDa+mndl RpalY+ayhe  a++ + e+   +++++Gp+C
  lcl|FitnessBrowser__Korea:Ga0059261_2051 277 GRFICGNAGVLVTEVIWVKPAAGNPYVIVDAAMNDLARPALYDAYHEFEAVEPTGEK--FVANIAGPVC 343
                                               ***************************************************886666..9********* PP

                                 TIGR01048 348 EsgDvlakdrelpeveeGdllavasaGAYgasmssnYnsrprpaevlveegkarlirrretledlla 414
                                               E+gD++a  re++ v++Gdl + + aGAYga+m+s+Ynsr+ + evlv++++  ++  r + e ++ 
  lcl|FitnessBrowser__Korea:Ga0059261_2051 344 ETGDTFAMGREIDVVKSGDLAVFRTAGAYGATMASTYNSRALVPEVLVSGDRFAVVADRIQPETIMG 410
                                               *********************************************************9988888775 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (417 nodes)
Target sequences:                          1  (419 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 6.77
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory