Align Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 (uncharacterized)
to candidate Ga0059261_2051 Ga0059261_2051 diaminopimelate decarboxylase
Query= curated2:Q9Z661 (421 letters) >lcl|FitnessBrowser__Korea:Ga0059261_2051 Ga0059261_2051 diaminopimelate decarboxylase Length = 419 Score = 425 bits (1092), Expect = e-123 Identities = 220/418 (52%), Positives = 290/418 (69%), Gaps = 3/418 (0%) Query: 4 FSLKNGTLCVEDIPLPEIAAQYGTPCYVYSHSYLTERARRFTKALDGAGKGKSLVAFAVK 63 F+ KNG L E++ +P IAA+ GTP YVYS + L A AL AG +AFA+K Sbjct: 4 FNRKNGVLHAENVSIPAIAAEVGTPVYVYSTATLERHASALKNAL--AGLPSVHLAFAIK 61 Query: 64 ANPSQAILASFAKEGLGADVVSAGEIRRAVHAGIPPERIVFSGVGKTAEEMRYALEIGIG 123 ANP+ A+L A++G GADVVS GE++RA+ AG+P E +VFSGVGKT E++ L+ GIG Sbjct: 62 ANPNLAVLGVLARQGYGADVVSGGELKRALAAGMPAEDVVFSGVGKTRAELQLGLDEGIG 121 Query: 124 QFNIESVSEIEMLAEVATSLGKKAAVALRINPDVDPHTHAKIATGKADTKFGIAAEDALS 183 QFN+E E E+LA++A + GK A LR+NPDVD THAKI+TGKA+ KFG+A + AL Sbjct: 122 QFNLELEEEGEVLADLAHAQGKTAPAVLRVNPDVDAGTHAKISTGKAENKFGVAIDRALE 181 Query: 184 AYEKLASYPSLKIQGIASHIGSQITDLAPFEAAAERIYEIITALEKAGHAIETADLGGGL 243 +++LA P L ++G+A HIGSQ+T+LAP EAA +R+ E++ L AGH I DLGGGL Sbjct: 182 IFDRLAKRPGLNLRGVAIHIGSQLTELAPLEAAYKRVGELVAQLRAAGHTITHVDLGGGL 241 Query: 244 GVRYKDDQPEPPSVEAYGEMIKRVTKGWNCRLIFEPGRSLIANAGVLLSKVIRIKESKTA 303 GV Y Q + E +G M+ RVT+GWN L+FEPGR + NAGVL+++VI +K + Sbjct: 242 GVPYHAGQ-TVSTAEEFGAMVARVTQGWNVTLMFEPGRFICGNAGVLVTEVIWVKPAAGN 300 Query: 304 RFVILDAAMNDLVRPTLYDAYHEIKAVTPSAQTYQADIVGPVCETGDIFARNRSISAVKA 363 +VI+DAAMNDL RP LYDAYHE +AV P+ + + A+I GPVCETGD FA R I VK+ Sbjct: 301 PYVIVDAAMNDLARPALYDAYHEFEAVEPTGEKFVANIAGPVCETGDTFAMGREIDVVKS 360 Query: 364 DDLMAIMSAGAYGATMASAYNSRPLVAEVMVSGNKSALIRKRQSVEDLMRDEQKVEWL 421 DL +AGAYGATMAS YNSR LV EV+VSG++ A++ R E +M E+ EW+ Sbjct: 361 GDLAVFRTAGAYGATMASTYNSRALVPEVLVSGDRFAVVADRIQPETIMGAERVPEWV 418 Lambda K H 0.317 0.132 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 480 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 419 Length adjustment: 32 Effective length of query: 389 Effective length of database: 387 Effective search space: 150543 Effective search space used: 150543 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate Ga0059261_2051 Ga0059261_2051 (diaminopimelate decarboxylase)
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01048.hmm # target sequence database: /tmp/gapView.2213.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01048 [M=417] Accession: TIGR01048 Description: lysA: diaminopimelate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-132 427.0 0.0 3.3e-132 426.9 0.0 1.0 1 lcl|FitnessBrowser__Korea:Ga0059261_2051 Ga0059261_2051 diaminopimelate d Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_2051 Ga0059261_2051 diaminopimelate decarboxylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 426.9 0.0 3.3e-132 3.3e-132 4 414 .. 6 410 .. 3 413 .. 0.96 Alignments for each domain: == domain 1 score: 426.9 bits; conditional E-value: 3.3e-132 TIGR01048 4 kkdgeleiegvdlkelaeefgtPlYvydeetlrerlealkeafkaees.lvlYAvKAnsnlavlrllae 71 +k+g l +e+v++ ++a+e gtP+Yvy+++tl+++++alk+a ++ s +++A+KAn nlavl +la+ lcl|FitnessBrowser__Korea:Ga0059261_2051 6 RKNGVLHAENVSIPAIAAEVGTPVYVYSTATLERHASALKNALAGLPSvHLAFAIKANPNLAVLGVLAR 74 68999***************************************966669******************* PP TIGR01048 72 eGlgldvvsgGEleralaAgvkaekivfsgngkseeeleaaleleiklinvdsveelelleeiakelgk 140 +G g+dvvsgGEl+ralaAg++ae++vfsg+gk+++el+ l+ +i +n++ +ee e l ++a+ +gk lcl|FitnessBrowser__Korea:Ga0059261_2051 75 QGYGADVVSGGELKRALAAGMPAEDVVFSGVGKTRAELQLGLDEGIGQFNLELEEEGEVLADLAHAQGK 143 ********************************************************************* PP TIGR01048 141 karvllRvnpdvdaktheyisTGlkesKFGieveeaeeayelalkleslelvGihvHIGSqildlepfv 209 +a+ +lRvnpdvda th +isTG++e+KFG+++++a+e++ + +k++ l+l G+ +HIGSq+++l+p++ lcl|FitnessBrowser__Korea:Ga0059261_2051 144 TAPAVLRVNPDVDAGTHAKISTGKAENKFGVAIDRALEIFDRLAKRPGLNLRGVAIHIGSQLTELAPLE 212 ********************************************************************* PP TIGR01048 210 eaaekvvklleelkeegieleeldlGGGlgisyeeeeeapdleeyaeklleklekeaelglklklilEp 278 +a ++v +l+++l+++g +++++dlGGGlg++y+ ++ ++ee+ ++++++++ g +++l++Ep lcl|FitnessBrowser__Korea:Ga0059261_2051 213 AAYKRVGELVAQLRAAGHTITHVDLGGGLGVPYHAGQTVSTAEEFG-AMVARVTQ----GWNVTLMFEP 276 ************************************9666666655.55556666....79******** PP TIGR01048 279 GRslvanagvlltrVesvKevesrkfvlvDagmndliRpalYeayheiaalkrleeeetetvdvvGplC 347 GR++ +nagvl+t+V vK + +v+vDa+mndl RpalY+ayhe a++ + e+ +++++Gp+C lcl|FitnessBrowser__Korea:Ga0059261_2051 277 GRFICGNAGVLVTEVIWVKPAAGNPYVIVDAAMNDLARPALYDAYHEFEAVEPTGEK--FVANIAGPVC 343 ***************************************************886666..9********* PP TIGR01048 348 EsgDvlakdrelpeveeGdllavasaGAYgasmssnYnsrprpaevlveegkarlirrretledlla 414 E+gD++a re++ v++Gdl + + aGAYga+m+s+Ynsr+ + evlv++++ ++ r + e ++ lcl|FitnessBrowser__Korea:Ga0059261_2051 344 ETGDTFAMGREIDVVKSGDLAVFRTAGAYGATMASTYNSRALVPEVLVSGDRFAVVADRIQPETIMG 410 *********************************************************9988888775 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (419 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 6.77 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory