Align [amino group carrier protein]-gamma-(L-lysyl)-L-glutamate aminotransferase (EC 2.6.1.118) (characterized)
to candidate Ga0059261_4131 Ga0059261_4131 Ornithine/acetylornithine aminotransferase
Query= BRENDA::Q93R93 (395 letters) >FitnessBrowser__Korea:Ga0059261_4131 Length = 398 Score = 211 bits (537), Expect = 3e-59 Identities = 137/378 (36%), Positives = 194/378 (51%), Gaps = 15/378 (3%) Query: 23 VYNKHDLLIVRGQGARVWDAEGNE-YIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMP 81 VY + + RG+GA ++ +G E Y+DCV G LGH +P +V A++ QA L + Sbjct: 8 VYARAPIAFDRGEGAWLYPVDGGEPYLDCVAGVATNALGHCHPVLVAALEAQAAKLWHIS 67 Query: 82 QTLPTPMRGEFYRTLTAILPPELNRVFPVNSGTEANEAALKFARAHTG------RKKFVA 135 P + LT + VF NSGTEA E A+K AR + R+ + Sbjct: 68 NMFEMPGQNALAERLTTA--SFADTVFFTNSGTEAVECAIKVARRYHAARGEPQRQTVIG 125 Query: 136 AMRGFSGRTMGSLSVTWEPKYREPFLPLVEPVEFIPYNDVEALKRAV-DEETAAVILEPV 194 F GRT G+++ P + + F + ++ AL A+ D TAAV++EPV Sbjct: 126 FSGAFHGRTYGAMNAAGNPAHLDGFGDRLPGFVHFAVDNWPALALAIADSATAAVVVEPV 185 Query: 195 QGEGGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHF-GIVPDILTLA 253 QGEGG R T FL R G LLI DE+QTGMGRTGK FA + + PDI+ LA Sbjct: 186 QGEGGARAMTEPFLDKLRAACTAHGVLLIYDEVQTGMGRTGKLFAHQWYPDATPDIMALA 245 Query: 254 KALGGGVPLGVAVMREEVARSMPKGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAAEL 313 KALG G P+G + E A M G HGTT GGNPLAMA +AA + + A E+ Sbjct: 246 KALGSGFPVGACLATAEAASGMVPGVHGTTAGGNPLAMAVAIAAFDEIAKPETLTHAREV 305 Query: 314 GPWF---MEKLRAIPSPKIREVRGMGLMVGLELKEKAAPYIARLEKEHRVLALQAGPTVI 370 +++L A I E+RG GL+VG+ L ++A +E R+L G + Sbjct: 306 AQHLRAGLDRLAATHPGVISEIRGKGLLVGVRLVPNNRAFMA-AAREQRLLVAGGGDNCV 364 Query: 371 RFLPPLVIEKEDLERVVE 388 R LPPL + + +++++ Sbjct: 365 RLLPPLTLTVAEADQILD 382 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 21 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 398 Length adjustment: 31 Effective length of query: 364 Effective length of database: 367 Effective search space: 133588 Effective search space used: 133588 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory