Align O-acetylhomoserine sulfhydrylase (EC:2.5.1.49) (characterized)
to candidate Ga0059261_1388 Ga0059261_1388 cystathionine beta-lyase, bacterial
Query= reanno::Korea:Ga0059261_3194 (402 letters) >FitnessBrowser__Korea:Ga0059261_1388 Length = 411 Score = 174 bits (440), Expect = 6e-48 Identities = 133/382 (34%), Positives = 187/382 (48%), Gaps = 15/382 (3%) Query: 24 GGTARSEW--GETSEALFLTSGYAYDCAGDAAARFSGD-QQGMTYSRLQNPTVEMLEQRI 80 G R EW G + ++ S YD D A D + Y R +PT L + + Sbjct: 30 GAGRRPEWTQGIVNAPVWRASTILYDTVADLRASAGSDTHHRLFYGRRGSPTQWSLAEAL 89 Query: 81 ALLE-GAEACRATASGMAAMTAALLCQLSAGDHLIGGRAAFGSCRWLTDTQLPKFGIETT 139 LE GAEA SG+AA++AALL LS GD L+ + + R L +FG+ T Sbjct: 90 TELEPGAEATFLYPSGVAAVSAALLSVLSPGDELLLADSVYDPTRSFATGFLKRFGVITR 149 Query: 140 VVDARDPQQFIDAIRPNTKVFFFETPANPTMDVVDLKAVCAIARERGIVTVVDNAFATPA 199 D + I T+ F ETP + T +V D+ A+ A A+ RG+VT++DN +ATP Sbjct: 150 FYDPMIGAGIAELITDKTRAIFMETPGSLTFEVQDVPAIVAAAKARGVVTLLDNTWATPL 209 Query: 200 LQRPMDFGADVVAYSATKMMDGQGRVLAGAVCGTEEFINNTLLPFHRNTGPTLSPFNAWV 259 L ++ G D+ + TK + G V+ G+V T E L G T SP +AW+ Sbjct: 210 LFPAIEKGIDLSILACTKYVVGHSDVMLGSVTATAEHWQQ-LRATSFALGQTASPDDAWL 268 Query: 260 VLKGLETLDLRIQRQSENALKVARFLEGR--VPRVNFPGLPSHPQHNLAMSQMAAAGPIF 317 +GL T+ LR+++ E AL++AR+LE R V RV P LPS P H+L + +F Sbjct: 269 GSRGLRTMALRLKQHGEAALEIARWLETRPEVARVLHPALPSCPGHDLFVRDFKGPAGLF 328 Query: 318 SIELDGGRTQAH-GLLDALGLIDISNNIGDSRSLMTHPASTTHSGVAEDQRLLMGVGEG- 375 S L GG L+D+L L I + G SL P + ++ EG Sbjct: 329 SFVLRGGNEAGRAALIDSLELFGIGYSWGGFESLAI-PVDPDRI-----RTVIPWQAEGP 382 Query: 376 MLRLNVGLEDPEDLIADLDQAL 397 +RL +GLEDP DLIADL L Sbjct: 383 AVRLQIGLEDPADLIADLAAGL 404 Lambda K H 0.319 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 379 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 411 Length adjustment: 31 Effective length of query: 371 Effective length of database: 380 Effective search space: 140980 Effective search space used: 140980 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory