Align Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 (characterized)
to candidate Ga0059261_0070 Ga0059261_0070 phosphoserine phosphatase SerB
Query= SwissProt::Q21YU0 (237 letters) >FitnessBrowser__Korea:Ga0059261_0070 Length = 313 Score = 169 bits (428), Expect = 6e-47 Identities = 98/208 (47%), Positives = 128/208 (61%), Gaps = 5/208 (2%) Query: 25 KLIAFDMDSTLINIECVDEIADAVGRKREVAAITEAAMRGEITDYKESLRQRVALLQGVT 84 +LI DMDST+I +EC+DE+AD G K ++A +TEAAMRGE+ D+ E+L RVALL+G+ Sbjct: 99 RLIVADMDSTMITVECIDELADYAGIKAQIAEVTEAAMRGEL-DFAEALDARVALLKGLG 157 Query: 85 EVQMNQIYQERMQFNPGAAELVAACKAAGLKVLLVSGGFTHFTDRVAQRLGIDYTRSNVL 144 +++ ER+Q PGA LV KA G +LVSGGFT F V +++G D +N L Sbjct: 158 ADAIDRCLAERVQLMPGARTLVQTMKANGATAILVSGGFTRFAQPVGEQIGFDRVIANEL 217 Query: 145 QIENGVLTGRMVDQPWGDICDGAEKRKMLLETCALLGIAPKQAIAVGDGANDLPMMREAG 204 IE G LTG V +P I D K LL A LG+ +AVGDGANDL M+++AG Sbjct: 218 LIEGGALTG-AVTKP---IVDSTTKETTLLGAMAELGLDESATLAVGDGANDLAMIKKAG 273 Query: 205 LSVAFHAKSAVRELANVSIESGGLDRLL 232 L VA+HAK V A I+ L LL Sbjct: 274 LGVAYHAKPIVAAAAGARIDHNDLTALL 301 Lambda K H 0.321 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 237 Length of database: 313 Length adjustment: 25 Effective length of query: 212 Effective length of database: 288 Effective search space: 61056 Effective search space used: 61056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
Align candidate Ga0059261_0070 Ga0059261_0070 (phosphoserine phosphatase SerB)
to HMM TIGR00338 (serB: phosphoserine phosphatase SerB (EC 3.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00338.hmm # target sequence database: /tmp/gapView.2400.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00338 [M=219] Accession: TIGR00338 Description: serB: phosphoserine phosphatase SerB Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-70 220.9 1.6 1.1e-69 220.5 1.6 1.1 1 lcl|FitnessBrowser__Korea:Ga0059261_0070 Ga0059261_0070 phosphoserine pho Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_0070 Ga0059261_0070 phosphoserine phosphatase SerB # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 220.5 1.6 1.1e-69 1.1e-69 10 217 .. 94 302 .. 87 303 .. 0.96 Alignments for each domain: == domain 1 score: 220.5 bits; conditional E-value: 1.1e-69 TIGR00338 10 llkkkklvvfDlDstlieeEvIdeiaklaGveeeVseiTerAmrgeldFkeslreRvkllkglpvellk 78 ++ k+l+v D+Dst+i+ E+Ide+a +aG++ +++e+Te AmrgeldF e+l Rv+llkgl ++ ++ lcl|FitnessBrowser__Korea:Ga0059261_0070 94 ANRRKRLIVADMDSTMITVECIDELADYAGIKAQIAEVTEAAMRGELDFAEALDARVALLKGLGADAID 162 56889*************************************************************666 PP TIGR00338 79 k.veeklelteGveelvkkLkekgykvaviSGgFdlvaeklkekLgldavfaNrLevedgkltGkvege 146 + +e+++l++G++ lv+++k +g +++SGgF+ +a+ + e++g d v+aN+L +e g+ltG v+ + lcl|FitnessBrowser__Korea:Ga0059261_0070 163 RcLAERVQLMPGARTLVQTMKANGATAILVSGGFTRFAQPVGEQIGFDRVIANELLIEGGALTGAVTKP 231 52789**************************************************************** PP TIGR00338 147 ivdesakaktllkllekegislektvavGDGanDlsmikaAglgiafnakpvlkekadiviekkdltdi 215 ivd+ +k tll + + g++ +t+avGDGanDl+mik+Aglg+a++akp++ +a + i+++dlt++ lcl|FitnessBrowser__Korea:Ga0059261_0070 232 IVDSTTKETTLLGAMAELGLDESATLAVGDGANDLAMIKKAGLGVAYHAKPIVAAAAGARIDHNDLTAL 300 *******************************************************************99 PP TIGR00338 216 le 217 l+ lcl|FitnessBrowser__Korea:Ga0059261_0070 301 LY 302 75 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (219 nodes) Target sequences: 1 (313 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.30 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory