GapMind for Amino acid biosynthesis


Aligments for a candidate for trpB in Sphingomonas koreensis DSMZ 15582

Align candidate Ga0059261_0238 Ga0059261_0238 (tryptophan synthase, beta subunit)
to HMM TIGR00263 (trpB: tryptophan synthase, beta subunit (EC

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00263.hmm
# target sequence database:        /tmp/gapView.13645.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00263  [M=385]
Accession:   TIGR00263
Description: trpB: tryptophan synthase, beta subunit
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
   5.7e-198  643.6   0.0   6.5e-198  643.4   0.0    1.0  1  lcl|FitnessBrowser__Korea:Ga0059261_0238  Ga0059261_0238 tryptophan syntha

Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Korea:Ga0059261_0238  Ga0059261_0238 tryptophan synthase, beta subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  643.4   0.0  6.5e-198  6.5e-198       1     384 [.      15     398 ..      15     399 .. 1.00

  Alignments for each domain:
  == domain 1  score: 643.4 bits;  conditional E-value: 6.5e-198
                                 TIGR00263   1 gkfgefGGqyvpevllealeelekayekakkdeefkkeleellkeyagrptpltfaknlskklggakiy 69 
                                               g+fg+fGG+yv+e+l++ + +le++y+ ak+d++f++e++ l+k+y+grp+pl+fa++l++++ggakiy
                                               68******************************************************************* PP

                                 TIGR00263  70 lkredllhtGahkinnalgqallakrlGkkriiaetGaGqhGvatataaallglecevymGaedverqk 138
                                               +kre+l+htGahkinn +gq+lla r+GkkriiaetGaGqhGvatat++a++gl c+++mGa+d+erq+
                                               ********************************************************************* PP

                                 TIGR00263 139 lnvfrmellgakvvpvtsGsktlkdavnealrdWvtsvedthyvlGsavGphPfPeivrefqsvigeev 207
                                               +nvfrm+llga+v pvtsGs++lkda+nealrdWv++v+dt+y++G+a+GphP+Pe+vr+fqsvig+e 
                                               ********************************************************************* PP

                                 TIGR00263 208 keqilekegrlPdaviacvGGGsnaiGifaafiedeeveligveagGkGidtekhaatlskGkeGvlhG 276
                                               ++q+le+egrlPd +ia+vGGGsnaiG+f++f++d++v+++gvea+GkGidt++haa+l+ G +G+lhG
                                               ********************************************************************* PP

                                 TIGR00263 277 aktkllqdedGqieeahsvsaGldypgvgPehaalaetgraeyeaitdeealealkllskeeGiipale 345
                                               +kt+llqdedGqi+eahs+saGldypg+gPeh++l+e+gr+ey  +td++al+a++l++k eGiipale
                                               ********************************************************************* PP

                                 TIGR00263 346 sshalaaleklapklkkdeivvvnlsGrGdkdletvaka 384
                                               sshalaale+ a +l+ d+i++vn+sGrGdkd+ tva+a
  lcl|FitnessBrowser__Korea:Ga0059261_0238 360 SSHALAALEHKARELPSDKIILVNVSGRGDKDIYTVAQA 398
                                               ************************************986 PP

Internal pipeline statistics summary:
Query model(s):                            1  (385 nodes)
Target sequences:                          1  (403 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01
# Mc/sec: 12.36

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory