Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate Ga0059261_0929 Ga0059261_0929 anthranilate phosphoribosyltransferase
Query= SwissProt::P83827 (329 letters) >FitnessBrowser__Korea:Ga0059261_0929 Length = 331 Score = 233 bits (594), Expect = 5e-66 Identities = 139/318 (43%), Positives = 185/318 (58%), Gaps = 7/318 (2%) Query: 13 LEEEEAYEVMRALMAGEVSPVRAAGLLVALSLRGERPHEIAAMARAMREAARPLRVHRRP 72 L E A + ++ G L+ALS RGE EIA ARAMR+ P+ Sbjct: 14 LAREAAAQAFADILDGSAPEPEIEAFLIALSERGETSIEIAEAARAMRQRVIPVSAPANA 73 Query: 73 LLDIVGTGGDGKGLMNLSTLAALVAAAGGVAVAKHGNRAASSRAGSADLLEALGVDLEAP 132 + D+ GTGGDG +N+ST A+V AA GV VAKHGNRAASS++G+AD LEALG+DL+ Sbjct: 74 I-DVCGTGGDGHHTLNVSTAVAIVVAAAGVPVAKHGNRAASSKSGAADTLEALGLDLDRA 132 Query: 133 PERVGEAIEELGFGFLFARVFHPAMRHVAPVRAELGVRTVFNLLGPLTNPAGADAYVLGV 192 + +LG FLFA HPAM +AP+R + RT+FNL+GPL NPAG ++G+ Sbjct: 133 AANAEAHLNDLGIAFLFAAKHHPAMGRIAPLRRRIARRTIFNLMGPLANPAGVQRQLIGI 192 Query: 193 FSPEWLAPMAEALERLGARG--LVVHGEGADEL-VLGENRVVEVGKGA--YALTPEEVGL 247 P++ AEALE+LG +G +V EG DEL G + VV +G + +TP + GL Sbjct: 193 ARPDYAPIYAEALEQLGVKGAAIVAGEEGLDELSPEGGSLVVSIGDVSLPVRVTPADAGL 252 Query: 248 KRAPLEALKGGGPEENAALARRLLKGEEKGPLADAVALAAGAGFYAAGKTPSLKEGVALA 307 PL +L+GG ENAA RRLL G E+GP DAV + A AG+ L+EG A Sbjct: 253 PSHPLVSLRGGDARENAAALRRLLLG-ERGPYRDAVLFNSAAALVVAGEAVDLREGAEEA 311 Query: 308 REVLASGEAYLLLERYVA 325 E + G A LL+ ++A Sbjct: 312 AETIDKGLANALLDCWIA 329 Lambda K H 0.317 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 331 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 331 Length adjustment: 28 Effective length of query: 301 Effective length of database: 303 Effective search space: 91203 Effective search space used: 91203 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate Ga0059261_0929 Ga0059261_0929 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.3718.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-107 344.2 0.1 5e-107 344.0 0.1 1.0 1 lcl|FitnessBrowser__Korea:Ga0059261_0929 Ga0059261_0929 anthranilate phos Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_0929 Ga0059261_0929 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 344.0 0.1 5e-107 5e-107 9 328 .. 13 328 .. 10 330 .. 0.98 Alignments for each domain: == domain 1 score: 344.0 bits; conditional E-value: 5e-107 TIGR01245 9 dLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkvekeeseelvDivGT 77 L++e a+q++ i++g+a + +i A+l+al +get eia++a+a+r++ v++ ++++D++GT lcl|FitnessBrowser__Korea:Ga0059261_0929 13 PLAREAAAQAFADILDGSAPEPEIEAFLIALSERGETSIEIAEAARAMRQRVIPVSA--PANAIDVCGT 79 7999***************************************************88..79******** PP TIGR01245 78 GGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsleevgigFl 146 GGDg +t+N+STa a+v+aaaGv+vaKhGnr++ssksG+aD+Lealg+ l+ ++++++ l+++gi+Fl lcl|FitnessBrowser__Korea:Ga0059261_0929 80 GGDGHHTLNVSTAVAIVVAAAGVPVAKHGNRAASSKSGAADTLEALGLDLDRAAANAEAHLNDLGIAFL 148 ********************************************************************* PP TIGR01245 147 fAPkyhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlgvkralvvh 215 fA k+hpa+ ++ap+R++++ rt+fNl+GPL+nPa +++q++G++++d++ ++ae+l++lgvk a +v lcl|FitnessBrowser__Korea:Ga0059261_0929 149 FAAKHHPAMGRIAPLRRRIARRTIFNLMGPLANPAGVQRQLIGIARPDYAPIYAEALEQLGVKGAAIVA 217 ********************************************************************* PP TIGR01245 216 gedglDEisltgetkvaelkdgeieeytlspedfglkraeleelkggsaeenaellkevlegkekkakr 284 ge+glDE+s+ g + v+++ + +++p+d gl+ ++l +l+gg+a+ena++l+++l g+ ++ r lcl|FitnessBrowser__Korea:Ga0059261_0929 218 GEEGLDELSPEGGSLVVSIG-DVSLPVRVTPADAGLPSHPLVSLRGGDARENAAALRRLLLGER-GPYR 284 ******************98.5556899**********************************98.99** PP TIGR01245 285 divvlNaaaalyvagkakdlkegvelakeaiksgkalekleelv 328 d+v++N aaal+vag+a dl+eg+e a e+i++g a ++l+ ++ lcl|FitnessBrowser__Korea:Ga0059261_0929 285 DAVLFNSAAALVVAGEAVDLREGAEEAAETIDKGLANALLDCWI 328 ************************************99999887 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (331 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.06 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory