Align Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 (characterized)
to candidate Ga0059261_0256 Ga0059261_0256 anthranilate synthase component I, non-proteobacterial lineages
Query= SwissProt::P20579 (493 letters) >FitnessBrowser__Korea:Ga0059261_0256 Length = 508 Score = 355 bits (910), Expect = e-102 Identities = 218/474 (45%), Positives = 282/474 (59%), Gaps = 26/474 (5%) Query: 24 LADFDTPLSIYLKLADQPNS-YLLESVQGGEKWGRYSMIGLPSRTVMRVHGYHVSILHDG 82 LAD DTP+S LKL + +LLESV+GG GR+S+IGL V R HG I + Sbjct: 32 LADTDTPVSAALKLIEPGRGDFLLESVEGGAVRGRHSLIGLAPDLVFRAHGQQAEI--NP 89 Query: 83 VEVESHDVEDPLA--FVESFKDRYKVA--DIPG-LPRFNGGLVGYFGYDCVRYVEKRLGV 137 + D P A +E+ + + D+P LPR LVGYFGY+ + VE Sbjct: 90 FWLTDRDAFAPAAQPTLEALRTLVQSCRMDVPAELPRALACLVGYFGYETIGLVETL--P 147 Query: 138 SPNPDPLGVPDILLMVSDAVVVFDNLAGKMHAIVLVDPAEEQAFEQGQARLQGLLETL-- 195 + D LG+PD++ + +++FD LA ++ LV P + +ARL E + Sbjct: 148 RADEDALGLPDMIFVRPTVILIFDRLAD---SLFLVAPVWPGSTRDPEARLADAAERIDA 204 Query: 196 ------RQPITPRRGLDLSGPQAAEPEFRSSYTREDYENAVGRIKEYILAGDCMQVVPSQ 249 P+ P+ D A E R + DY V R KEYI AGD QVV +Q Sbjct: 205 TAARLATAPLPPKVAGD-----ALEIAARPTLADGDYAAMVARAKEYITAGDIFQVVLAQ 259 Query: 250 RMSIDFKAAPIDLYRALRCFNPTPYMYFFNFGDFHVVGSSPEVLVRVEDNLVTVRPIAGT 309 R + F PI+LYRALR NP+P++YF + F + GSSPE+LVRV D+ VT+RPIAGT Sbjct: 260 RFTAPFALPPIELYRALRRVNPSPFLYFLDLPGFALTGSSPEILVRVRDDEVTIRPIAGT 319 Query: 310 RPRGATEEADRALEDDLLSDDKEIAEHLMLIDLGRNDVGRVSSTGSVRLTEKMVIERYSN 369 RPRG T D A LL+D KE AEHLML+DLGRND GRV+ G+VR+T+ +E YS+ Sbjct: 320 RPRGKTAAEDEANRTSLLADPKERAEHLMLLDLGRNDTGRVAQAGTVRVTDSYTVEFYSH 379 Query: 370 VMHIVSNVAGQLREGLTAMDALRAILPAGTLSGAPKIRAMEIIDELEPVKRGVYGGAVGY 429 VMHIVSNV G+LR A+DAL A PAGT+SGAPK+RA EII ELE +RG Y G VGY Sbjct: 380 VMHIVSNVVGKLRPDADALDALFAGFPAGTVSGAPKVRACEIIAELEREQRGPYAGGVGY 439 Query: 430 FAWNGNMDTAIAIRTAVINDGELHVQAGGGIVADSVPALEWEETINKRRAMFRA 483 F+ +G+MD+ I +RTA++ DG +HV AG GIVADS A E E K A+F A Sbjct: 440 FSPDGSMDSCIVLRTAIVKDGTMHVTAGAGIVADSDAAYEQRECEAKAGALFAA 493 Lambda K H 0.320 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 676 Number of extensions: 33 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 493 Length of database: 508 Length adjustment: 34 Effective length of query: 459 Effective length of database: 474 Effective search space: 217566 Effective search space used: 217566 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
Align candidate Ga0059261_0256 Ga0059261_0256 (anthranilate synthase component I, non-proteobacterial lineages)
to HMM TIGR00564 (trpE: anthranilate synthase component I (EC 4.1.3.27))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00564.hmm # target sequence database: /tmp/gapView.3848.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00564 [M=455] Accession: TIGR00564 Description: trpE_most: anthranilate synthase component I Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.7e-160 518.7 0.0 9e-160 518.5 0.0 1.0 1 lcl|FitnessBrowser__Korea:Ga0059261_0256 Ga0059261_0256 anthranilate synt Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_0256 Ga0059261_0256 anthranilate synthase component I, non-proteobacterial linea # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 518.5 0.0 9e-160 9e-160 1 453 [. 33 493 .. 33 495 .. 0.93 Alignments for each domain: == domain 1 score: 518.5 bits; conditional E-value: 9e-160 TIGR00564 1 adtltpisvylklak.rkesfllEsvekeeelgRySliglnpvleikakdgkav....lleaddeeaki 64 adt tp+s++lkl + + fllEsve ++ +gR+Sligl p+l+++a++++a+ +l+ +d a lcl|FitnessBrowser__Korea:Ga0059261_0256 33 ADTDTPVSAALKLIEpGRGDFLLESVEGGAVRGRHSLIGLAPDLVFRAHGQQAEinpfWLTDRDAFAPA 101 5899**********9889*****************************9998654111134444444448 PP TIGR00564 65 eedelkelrklleka.eesedeldeplsggavGylgydtvrlveklkeeaedelelpdlllllvetviv 132 + l++lr+l++++ + el+ + + +vGy+gy+t+ lve+l+++ ed+l lpd++++ + +++ lcl|FitnessBrowser__Korea:Ga0059261_0256 102 AQPTLEALRTLVQSCrMDVPAELPRA-LACLVGYFGYETIGLVETLPRADEDALGLPDMIFVRPTVILI 169 88999**********44445567765.578*************************************** PP TIGR00564 133 fDhvekkvilienarteaers...aeeeaaarleellaelqkelekavkaleekkesftsnvekeeyee 198 fD +++++l++ + + r+ ++aa+r+++++a+l ++ + a + +++ +y++ lcl|FitnessBrowser__Korea:Ga0059261_0256 170 FDRLADSLFLVAPVWPGSTRDpeaRLADAAERIDATAARLATAPLPPKVAGDALEIAARPTLADGDYAA 238 *************9999888887778899999***99999998887766667777778899999***** PP TIGR00564 199 kvakakeyikaGdifqvvlSqrleakveakpfelYrkLRtvNPSpylyyldledfelvgsSPEllvkvk 267 va+akeyi+aGdifqvvl+qr++a++ ++p+elYr+LR+vNPSp+ly+ldl +f l gsSPE+lv+v+ lcl|FitnessBrowser__Korea:Ga0059261_0256 239 MVARAKEYITAGDIFQVVLAQRFTAPFALPPIELYRALRRVNPSPFLYFLDLPGFALTGSSPEILVRVR 307 ********************************************************************* PP TIGR00564 268 gkrvetrPiAGtrkRGatkeeDealeeeLladeKerAEHlmLvDLaRNDigkvaklgsvevkellkiek 336 +++v++rPiAGtr+RG+t +eDea+++ Llad+KerAEHlmL+DL+RND g+va++g+v+v++++++e lcl|FitnessBrowser__Korea:Ga0059261_0256 308 DDEVTIRPIAGTRPRGKTAAEDEANRTSLLADPKERAEHLMLLDLGRNDTGRVAQAGTVRVTDSYTVEF 376 ********************************************************************* PP TIGR00564 337 yshvmHivSeVeGelkdeltavDalraalPaGTlsGAPKvrAmelidelEkekRgiYgGavgylsfdgd 405 yshvmHivS+V+G+l+++++a+Dal a +PaGT+sGAPKvrA e+i+elE e+Rg+Y+G+vgy+s dg+ lcl|FitnessBrowser__Korea:Ga0059261_0256 377 YSHVMHIVSNVVGKLRPDADALDALFAGFPAGTVSGAPKVRACEIIAELEREQRGPYAGGVGYFSPDGS 445 ********************************************************************* PP TIGR00564 406 vdtaiaiRtmvlkdgvayvqAgaGiVaDSdpeaEyeEtlnKakallra 453 +d++i++Rt+++kdg+++v AgaGiVaDSd E +E+ Ka al a lcl|FitnessBrowser__Korea:Ga0059261_0256 446 MDSCIVLRTAIVKDGTMHVTAGAGIVADSDAAYEQRECEAKAGALFAA 493 *******************************************99766 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (455 nodes) Target sequences: 1 (508 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.03 # Mc/sec: 7.37 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory