Align Aspartate/prephenate aminotransferase; AspAT / PAT; EC 2.6.1.1; EC 2.6.1.79 (characterized)
to candidate Ga0059261_2226 Ga0059261_2226 Aspartate/tyrosine/aromatic aminotransferase
Query= SwissProt::A3PMF8 (400 letters) >FitnessBrowser__Korea:Ga0059261_2226 Length = 399 Score = 494 bits (1272), Expect = e-144 Identities = 247/395 (62%), Positives = 292/395 (73%) Query: 5 SDTLARVKPSQTIAVTNKARELAAAGRDVIGLGAGEPDFDTPDNIKAAAKRAIDAGRTKY 64 S L R++PS T+A+T++ EL G DVIGLGAGEPDFDTPD +K AA AI G TKY Sbjct: 4 SAALNRIQPSATLAMTSRVFELKRQGIDVIGLGAGEPDFDTPDFVKEAAIEAIRKGITKY 63 Query: 65 TAVDGIPELKRAICEKFERENGLKYTPAQVTVGTGGKQILYNALVATLNPGDEVIIPAPY 124 T VDG PELK AI KF R+NGL Y Q++V +GGK L+NA AT++ GDEV+IPAPY Sbjct: 64 TNVDGTPELKAAIVGKFARDNGLTYAENQISVNSGGKHTLFNAFCATIDAGDEVVIPAPY 123 Query: 125 WVSYPDMVLLAGGTPVSVAAGMETGFKLTPEQLEAAITPRTKWFIFNSPSNPTGAAYTRA 184 WVSYPD+V AGG PV +AAG E +K+ PEQLEAAIT RTKW + NSPSNPTGAAY+ A Sbjct: 124 WVSYPDVVEFAGGKPVFIAAGAEANYKIKPEQLEAAITARTKWVVLNSPSNPTGAAYSAA 183 Query: 185 ELAALCEVLMRHPQVWIMSDDMYEHLVFDDFDFTTPAQIEPGLYDRTLTCNGVSKAYCMT 244 EL AL EVL RHP V I +DDMYEH+++D F+F T AQ+ P LY+RTLT NGVSKAY MT Sbjct: 184 ELKALGEVLERHPNVLIYADDMYEHILYDGFEFATIAQVCPSLYERTLTANGVSKAYAMT 243 Query: 245 GWRIGYAAGPVELIRAMGTIQSQSTSNPCSIAQYAALEALSGPQEFLATNREAFQRRRDL 304 GWRIGYA GP LI+AMG +QSQSTSNPCS++Q A++ AL+G Q FL AFQ+RRDL Sbjct: 244 GWRIGYAGGPQWLIKAMGKLQSQSTSNPCSVSQAASVAALNGDQSFLKDRAAAFQKRRDL 303 Query: 305 VVSMLNEAKGVTCPNPEGAFYVYPDISGCIGKTSAGGAKITDDEAFASALLEETGVAVVF 364 VVSML + G+ CP PEGAFYVYP+ S IGKT+ G I DE LL++ VA V Sbjct: 304 VVSMLGQINGMNCPRPEGAFYVYPEFSQLIGKTTPKGLVIDTDETMVGYLLDDAKVAAVH 363 Query: 365 GAAFGLSPNFRISYATADEVLREACARIQAFCAGL 399 G AFG SP RISYAT+++VL EAC RIQ CA L Sbjct: 364 GGAFGFSPALRISYATSEDVLAEACGRIQEACAAL 398 Lambda K H 0.318 0.134 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 538 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 399 Length adjustment: 31 Effective length of query: 369 Effective length of database: 368 Effective search space: 135792 Effective search space used: 135792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory