Align branched-chain-amino-acid transaminase (EC 2.6.1.42); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized)
to candidate Ga0059261_3811 Ga0059261_3811 branched-chain amino acid aminotransferase, group II
Query= BRENDA::P54691 (305 letters) >FitnessBrowser__Korea:Ga0059261_3811 Length = 362 Score = 99.0 bits (245), Expect = 1e-25 Identities = 96/318 (30%), Positives = 149/318 (46%), Gaps = 31/318 (9%) Query: 9 YFEDKFVPFEDAKISVATHALHYGTAAFGGLRGIPDPEDPGTILLFRLDRHGDRLSKSAK 68 + + K V + AT LHY F GL+ D GT L FR + R +SA+ Sbjct: 48 WHDAKVVARGPLSLDPATAVLHYAQEIFEGLKAYRTG-DEGTAL-FRPLENARRFRESAQ 105 Query: 69 FLHY-DISAEKIKEVIVDFVKKNQP------DKSFYIRPLVYSSG--LGIAPRLHNLEKD 119 + ++ + I VK ++ S Y+RP +++S LG+ P L Sbjct: 106 RMAMPELPDDLFLGSIEALVKADREWIPQIEGGSLYLRPFMFASEVFLGVKPASEYL--- 162 Query: 120 FLVYGLEMGDYL--AADGVSCRISSWYRQEDRSFPLRGKISAAYITSALAKTEAVESGFD 177 +LV G Y A V+ +S Y + K Y +S +A+ EA+ G D Sbjct: 163 YLVIASPAGAYFKGGAPAVTIWVSDHYTRAAPGGTGAAKCGGNYASSLVAQAEAIREGCD 222 Query: 178 EAILMNSQGK--VCEATGMNVFMV-RNGQIVTPGNEQDILEGITRDSILTIAADLGIPTC 234 + + +++ + V E GMN+F V +G +VTP IL GITR+SILT+A + GI Sbjct: 223 QVVFLDAVERRWVEELGGMNLFFVFDDGSMVTPPLGGTILPGITRESILTLAREQGITVR 282 Query: 235 QRP--IDKSELMIAD----EVFLSGTAAKITPVKRIEN----FTLGGDRP--ITEKLRSV 282 + P ID+ + E F GTAA +TPV ++++ FT+G P +TE L++ Sbjct: 283 EEPYAIDQWKADAGSGKLVETFACGTAAVVTPVGKVKSRDGEFTIGSGGPGQVTEALKAR 342 Query: 283 LTAVTENREPKYQDWVFK 300 LTA+ + P WV + Sbjct: 343 LTAIQRGQAPDIHGWVHR 360 Lambda K H 0.320 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 362 Length adjustment: 28 Effective length of query: 277 Effective length of database: 334 Effective search space: 92518 Effective search space used: 92518 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory