Align Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 (uncharacterized)
to candidate BWI76_RS24630 BWI76_RS24630 putrescine aminotransferase
Query= curated2:Q8TUZ5 (389 letters) >FitnessBrowser__Koxy:BWI76_RS24630 Length = 468 Score = 316 bits (810), Expect = 8e-91 Identities = 178/374 (47%), Positives = 238/374 (63%), Gaps = 18/374 (4%) Query: 32 DDEGNEYIDLVAGIAVNVLGHCHPAVVEAVKEQVERLIHCSNLYYNEPQAEAARLLAEAA 91 D +G E+ID + G + +GH +P VV AV+ Q+ + S + +A A+ LA Sbjct: 87 DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVENQLAKQPLHSQELLDPLRAMLAKTLAALT 146 Query: 92 PKDLNKVFFCNSGTESVECAIKLARKFT---GCTKFIAFEGGFHGRTMGALSATWKPEFR 148 P L FF NSGTESVE A+KLA+ + G F+A G FHG+++GALSAT K FR Sbjct: 147 PGKLKYSFFSNSGTESVEAALKLAKAYQSPRGKFTFVATSGAFHGKSLGALSATAKSTFR 206 Query: 149 EPFEPLVPEFEHVPYGDVNAVE------KAIDDDTAAVIVEPVQGEAGVRIPPEGFLREL 202 +PF PL+P F HVP+GD+NA+ K DD AAVI+EP+QGE GV +PP G+L + Sbjct: 207 KPFMPLLPGFRHVPFGDINAMRTLLSECKKTGDDVAAVILEPIQGEGGVILPPPGYLPAV 266 Query: 203 RELCDEHGLLLIVDEVQSGMGRTGQFFAFEHEDVLPDIVCLAKGLGGGV-PVGATIAREE 261 R+LCDE G LLI+DEVQ+GMGRTG+ FA EHE+V PDI+CLAK LGGGV P+GATIA EE Sbjct: 267 RKLCDEFGALLILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGATIATEE 326 Query: 262 VAEAF--EPGDHGSTFGGNPLACAAVCAAVSTVLEENLPEAAERKGKLAM----RILSEA 315 V P H +TFGGNPLACAA A ++ +L +NLP AE+KG + + ++ E Sbjct: 327 VFSVLFDNPFLHTTTFGGNPLACAAALATINVLLTQNLPAQAEQKGDMLLDGFRQLAREY 386 Query: 316 EDVVEEVRGRGLMMGVEVGDDERAKDVAREMLDRGALV--NVTSGDVIRLVPPLVIGEDE 373 D+V EVRG+G++M +E D+E D A EM + LV + + IR+ PPL + ++ Sbjct: 387 PDLVNEVRGKGMLMAIEFVDNEIGYDFASEMFRQRVLVAGTLNNARTIRVEPPLTLTLEQ 446 Query: 374 LEKALAELADALRA 387 E+ L AL A Sbjct: 447 CEQVLKAARLALAA 460 Lambda K H 0.318 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 461 Number of extensions: 28 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 468 Length adjustment: 32 Effective length of query: 357 Effective length of database: 436 Effective search space: 155652 Effective search space used: 155652 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory