Align Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 (uncharacterized)
to candidate BWI76_RS26375 BWI76_RS26375 aspartate aminotransferase family protein
Query= curated2:P59317 (406 letters) >FitnessBrowser__Koxy:BWI76_RS26375 Length = 421 Score = 230 bits (587), Expect = 5e-65 Identities = 137/398 (34%), Positives = 197/398 (49%), Gaps = 33/398 (8%) Query: 30 KGQGSRIWDQQGKEYVDFAGGIAVTALGHCHPALVNALKTQGETLWHIS-NVFTNEPALR 88 K + + +WD +G E +DFA GIAV GH HP ++ A++ Q + H + + E + Sbjct: 28 KAENATLWDIEGNEVIDFAAGIAVLNTGHRHPKIIAAVEQQLQAFTHTAYQIVPYESYVT 87 Query: 89 LGRK---LIEATFAERVVFMNSGTEANETAFKLARHYACVRHSPFKTKIIAFHNAFHGRS 145 L + L + F +G EA E A K+AR Y + +I F FHGR+ Sbjct: 88 LAERINALAPIDGPAKTAFFTTGAEAVENAVKIARAYTG------RPGLITFGGGFHGRT 141 Query: 146 LFTVSVGGQ-PKYSDGFGPKPADIIHVPF-NDLHAVKA--------------VMDDHTCA 189 T+++ G+ Y GFGP P + H + N H + + D A Sbjct: 142 FMTMALTGKVAPYKIGFGPFPGSVYHAVYPNAAHGITTADAMKSLDRIFKADIAADQVAA 201 Query: 190 VVVEPIQGEGGVTAATPEFLQGLRELCDQHQALLVFDEVQCGMGRTGDLFAYMHYGVTPD 249 +V+EPIQGEGG A PEF+Q LR LCD H LL+ DEVQ G RTG LFA HY V PD Sbjct: 202 IVLEPIQGEGGFNVAPPEFMQALRALCDTHGILLIADEVQTGFARTGKLFAMQHYDVKPD 261 Query: 250 ILTSAKALGGGFPVSAMLTTAEIASAFHPGSHGSTYGGNPLACAVAGAAFDIINTPEVLE 309 ++T AK+L GGFP+S ++ AE+ A PG G TY GNPLA A A A D+I ++ + Sbjct: 262 LMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGNPLAVAAAHAVLDVIEEEQLCQ 321 Query: 310 GIQAKRQHFVDHLQKIDQQYDVFSDIRGMGLLIGAELKPQYKGR-----ARDFLYAGAEE 364 + H + L + Q +D+RG G ++ E G R E Sbjct: 322 RAERLGSHLKEVLNQARQSCPAIADVRGQGSMVAVEFNDPQTGEPSAEITRQIQQKAQEN 381 Query: 365 GVMVLNAG--PDVMRFAPSLVVEDADIDEGMHRFAHAV 400 G+++L+ G +V+RF L + DA + + A + Sbjct: 382 GLLLLSCGVYGNVIRFLYPLTIPDAQFTKALDILARVL 419 Lambda K H 0.322 0.138 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 461 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 421 Length adjustment: 31 Effective length of query: 375 Effective length of database: 390 Effective search space: 146250 Effective search space used: 146250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory