GapMind for Amino acid biosynthesis

 

Aligments for a candidate for lysA in Klebsiella michiganensis M5al

Align Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 (characterized)
to candidate BWI76_RS23360 BWI76_RS23360 diaminopimelate decarboxylase

Query= SwissProt::E0IWI3
         (420 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS23360 BWI76_RS23360
           diaminopimelate decarboxylase
          Length = 420

 Score =  756 bits (1951), Expect = 0.0
 Identities = 366/420 (87%), Positives = 396/420 (94%)

Query: 1   MPHSLFSTDTDLTAENLLRLPAEFGCPVWVYDAQIIRRQIAALKQFDVVRFAQKACSNIH 60
           MPHSL++TDTDL+AENLLRLPAEFGCPVWVYDAQIIRRQIA L +FDVVRFAQKACSNIH
Sbjct: 1   MPHSLYATDTDLSAENLLRLPAEFGCPVWVYDAQIIRRQIAQLSKFDVVRFAQKACSNIH 60

Query: 61  ILRLMREQGVKVDSVSLGEIERALAAGYNPQTHPDDIVFTADVIDQATLERVSELQIPVN 120
           ILRLMREQGVKVDSVSLGEIERALAAGY+P  HPDD+VFTAD+ID ATL RV ELQIPVN
Sbjct: 61  ILRLMREQGVKVDSVSLGEIERALAAGYDPHQHPDDVVFTADLIDDATLARVKELQIPVN 120

Query: 121 AGSVDMLDQLGQVSPGHRVWLRVNPGFGHGHSQKTNTGGENSKHGIWYTDLPAALDVIQR 180
           AGS+DML QLG+VSPGHRVWLRVNPGFGHGHSQKTNTGGENSKHGIW++ L AAL+V++R
Sbjct: 121 AGSIDMLSQLGEVSPGHRVWLRVNPGFGHGHSQKTNTGGENSKHGIWHSHLTAALEVMRR 180

Query: 181 HHLQLVGIHMHIGSGVDYAHLEQVCGAMVRQVIEFGQDLQAISAGGGLSVPYQQGEEAVD 240
           + LQLVGIHMHIGSGVDY HLEQVCGAMVRQV+EFGQDLQAISAGGGLS+PY + EEA+D
Sbjct: 181 YQLQLVGIHMHIGSGVDYGHLEQVCGAMVRQVVEFGQDLQAISAGGGLSIPYHEDEEAID 240

Query: 241 TEHYYGLWNAAREQIARHLGHPVKLEIEPGRFLVAQSGVLITQVRSVKQMGSRHFVLVDA 300
           T+HY+GLWNAAREQIA+HLGHPVKLEIEPGRFLVA+SGVL++QVRSVK+MGSRHFVL+DA
Sbjct: 241 TDHYFGLWNAAREQIAKHLGHPVKLEIEPGRFLVAESGVLVSQVRSVKEMGSRHFVLIDA 300

Query: 301 GFNDLMRPAMYGSYHHISALAADGRSLEHAPTVETVVAGPLCESGDVFTQQEGGNVETRA 360
           GFNDLMRPAMYGSYHHI+ALAADGR L  A  +ETVVAGPLCESGDVFTQQEGG VETR 
Sbjct: 301 GFNDLMRPAMYGSYHHITALAADGRDLRAAAQIETVVAGPLCESGDVFTQQEGGKVETRL 360

Query: 361 LPEVKAGDYLVLHDTGAYGASMSSNYNSRPLLPEVLFDNGQARLIRRRQTIEELLALELL 420
           LP V  GDYLVLHDTGAYGASMSSNYNSRPLLPEVLFDNG+ARLIRRRQTIEELLALELL
Sbjct: 361 LPAVAPGDYLVLHDTGAYGASMSSNYNSRPLLPEVLFDNGKARLIRRRQTIEELLALELL 420


Lambda     K      H
   0.320    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 731
Number of extensions: 23
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 420
Length of database: 420
Length adjustment: 32
Effective length of query: 388
Effective length of database: 388
Effective search space:   150544
Effective search space used:   150544
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

Align candidate BWI76_RS23360 BWI76_RS23360 (diaminopimelate decarboxylase)
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01048.hmm
# target sequence database:        /tmp/gapView.13599.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01048  [M=417]
Accession:   TIGR01048
Description: lysA: diaminopimelate decarboxylase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                               -----------
   7.9e-142  458.5   0.0   9.7e-142  458.2   0.0    1.0  1  lcl|FitnessBrowser__Koxy:BWI76_RS23360  BWI76_RS23360 diaminopimelate de


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Koxy:BWI76_RS23360  BWI76_RS23360 diaminopimelate decarboxylase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  458.2   0.0  9.7e-142  9.7e-142       7     416 ..       8     418 ..       3     419 .. 0.97

  Alignments for each domain:
  == domain 1  score: 458.2 bits;  conditional E-value: 9.7e-142
                               TIGR01048   7 geleiegvdlkelaeefgtPlYvydeetlrerlealkeafkaeeslvlYAvKAnsnlavlrllaeeGlgld 77 
                                             +++++++ +l +l +efg+P++vyd++ +r+++++l++++     +v +A+KA+sn+++lrl++e+G+++d
  lcl|FitnessBrowser__Koxy:BWI76_RS23360   8 TDTDLSAENLLRLPAEFGCPVWVYDAQIIRRQIAQLSKFD-----VVRFAQKACSNIHILRLMREQGVKVD 73 
                                             67788999*****************************998.....79************************ PP

                               TIGR01048  78 vvsgGEleralaAgvk....aekivfsgngkseeeleaaleleiklinvdsveelelleeiakelgkkarv 144
                                             +vs GE+eralaAg++    ++++vf+++ +++++l+++ el+i  +n++s+++l++l e+++++    rv
  lcl|FitnessBrowser__Koxy:BWI76_RS23360  74 SVSLGEIERALAAGYDphqhPDDVVFTADLIDDATLARVKELQIP-VNAGSIDMLSQLGEVSPGH----RV 139
                                             ***************9888899**********************9.*******************....** PP

                               TIGR01048 145 llRvnpdvdaktheyisTGlkesKFGieveeaeeayelalkleslelvGihvHIGSqildlepfveaaekv 215
                                             +lRvnp++++ ++++++TG ++sK+Gi+++ ++ a+  ++++ +l+lvGih+HIGS++++ +  + + ++v
  lcl|FitnessBrowser__Koxy:BWI76_RS23360 140 WLRVNPGFGHGHSQKTNTGGENSKHGIWHS-HLTAALEVMRRYQLQLVGIHMHIGSGVDYGHLEQVCGAMV 209
                                             *****************************9.7788888899999*************************** PP

                               TIGR01048 216 vklleelkeegieleeldlGGGlgisyeeeeeapdleeyaeklleklekea.elglklklilEpGRslvan 285
                                              +++e     g++l+++++GGGl+i+y+e+eea+d+++y   ++++ e+ a +lg+ +kl +EpGR+lva+
  lcl|FitnessBrowser__Koxy:BWI76_RS23360 210 RQVVEF----GQDLQAISAGGGLSIPYHEDEEAIDTDHYFGLWNAAREQIAkHLGHPVKLEIEPGRFLVAE 276
                                             ******....9***************************************99******************* PP

                               TIGR01048 286 agvlltrVesvKevesrkfvlvDagmndliRpalYeayheiaalkr....leeeetetvdvvGplCEsgDv 352
                                             +gvl+ +V+svKe++sr+fvl+Dag+ndl+Rpa+Y++yh+i+al++    l+++++ ++ v+GplCEsgDv
  lcl|FitnessBrowser__Koxy:BWI76_RS23360 277 SGVLVSQVRSVKEMGSRHFVLIDAGFNDLMRPAMYGSYHHITALAAdgrdLRAAAQIETVVAGPLCESGDV 347
                                             *******************************************98777778899999************** PP

                               TIGR01048 353 lakd.......relpeveeGdllavasaGAYgasmssnYnsrprpaevlveegkarlirrretledllale 416
                                             ++++       r lp+v +Gd+l+++++GAYgasmssnYnsrp + evl+++gkarlirrr+t+e+llale
  lcl|FitnessBrowser__Koxy:BWI76_RS23360 348 FTQQeggkvetRLLPAVAPGDYLVLHDTGAYGASMSSNYNSRPLLPEVLFDNGKARLIRRRQTIEELLALE 418
                                             **********999*******************************************************998 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (417 nodes)
Target sequences:                          1  (420 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02
# Mc/sec: 7.30
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory