Align [amino group carrier protein]-gamma-(L-lysyl)-L-glutamate aminotransferase (EC 2.6.1.118) (characterized)
to candidate BWI76_RS24630 BWI76_RS24630 putrescine aminotransferase
Query= BRENDA::Q93R93 (395 letters) >FitnessBrowser__Koxy:BWI76_RS24630 Length = 468 Score = 261 bits (668), Expect = 2e-74 Identities = 159/373 (42%), Positives = 215/373 (57%), Gaps = 18/373 (4%) Query: 41 DAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQTLPTPMRGEFYRTLTAIL 100 D +G E+IDC+GG+G+ N+GH NP VV AV+ Q Q L P+R +TL A+ Sbjct: 87 DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVENQLAKQPLHSQELLDPLRAMLAKTLAALT 146 Query: 101 PPELNRVFPVNSGTEANEAALKFARAHT---GRKKFVAAMRGFSGRTMGSLSVTWEPKYR 157 P +L F NSGTE+ EAALK A+A+ G+ FVA F G+++G+LS T + +R Sbjct: 147 PGKLKYSFFSNSGTESVEAALKLAKAYQSPRGKFTFVATSGAFHGKSLGALSATAKSTFR 206 Query: 158 EPFLPLVEPVEFIPYNDVEALKRAVDE------ETAAVILEPVQGEGGVRPATPEFLRAA 211 +PF+PL+ +P+ D+ A++ + E + AAVILEP+QGEGGV P +L A Sbjct: 207 KPFMPLLPGFRHVPFGDINAMRTLLSECKKTGDDVAAVILEPIQGEGGVILPPPGYLPAV 266 Query: 212 REITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALGGGV-PLGVAVMREE 270 R++ E GALLILDE+QTGMGRTGK FA EH + PDIL LAKALGGGV P+G + EE Sbjct: 267 RKLCDEFGALLILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGATIATEE 326 Query: 271 VARSMPKGG--HGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWFMEKLRAIP--- 325 V + H TTFGGNPLA AA +A I L L +A + G ++ R + Sbjct: 327 VFSVLFDNPFLHTTTFGGNPLACAAALATINVLLTQNLPAQAEQKGDMLLDGFRQLAREY 386 Query: 326 SPKIREVRGMGLMVGLELKEKAAPYIARLEK-EHRVLALQA--GPTVIRFLPPLVIEKED 382 + EVRG G+++ +E + Y E RVL IR PPL + E Sbjct: 387 PDLVNEVRGKGMLMAIEFVDNEIGYDFASEMFRQRVLVAGTLNNARTIRVEPPLTLTLEQ 446 Query: 383 LERVVEAVRAVLA 395 E+V++A R LA Sbjct: 447 CEQVLKAARLALA 459 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 427 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 468 Length adjustment: 32 Effective length of query: 363 Effective length of database: 436 Effective search space: 158268 Effective search space used: 158268 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory