Align branched-chain-amino-acid transaminase (EC 2.6.1.42); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized)
to candidate BWI76_RS00970 BWI76_RS00970 branched chain amino acid aminotransferase
Query= BRENDA::P54691 (305 letters) >FitnessBrowser__Koxy:BWI76_RS00970 Length = 309 Score = 171 bits (432), Expect = 3e-47 Identities = 102/296 (34%), Positives = 163/296 (55%), Gaps = 19/296 (6%) Query: 9 YFEDKFVPFEDAKISVATHALHYGTAAFGGLRGIPDPEDPGTILLFRLDRHGDRLSKSAK 68 +F + VP+ +AK+ V +HALHYGT+ F G+R + P ++FR H RL SAK Sbjct: 10 WFNGEMVPWGEAKVHVMSHALHYGTSVFEGIRCYDSHKGP---VVFRHREHMQRLHDSAK 66 Query: 69 FLHYDIS--AEKIKEVIVDFVKKNQPDKSFYIRPLVYSS--GLGIAPRLHNLEKDFLVYG 124 + +S +++ E + ++KN S YIRPLV+ G+G+ P D ++ Sbjct: 67 IYRFPVSQSVDELMEACREVIRKNSLT-SAYIRPLVFVGDVGMGVNPP-PGYNTDVIIAA 124 Query: 125 LEMGDYLAAD----GVSCRISSWYRQEDRSFPLRGKISAAYITSALAKTEAVESGFDEAI 180 G YL A+ G+ +SSW R + P K Y++S L +EA G+ E I Sbjct: 125 FPWGAYLGAEALDQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGI 184 Query: 181 LMNSQGKVCEATGMNVFMVRNGQIVTPGNEQDILEGITRDSILTIAADLGIPTCQRPIDK 240 ++ G + E G N+F V++G + TP L GITRD+I+ +A DLG+ ++ + + Sbjct: 185 ALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKDLGLEVREQVLSR 244 Query: 241 SELMIADEVFLSGTAAKITPVKRIENFTLGGDR--PITEKLR----SVLTAVTENR 290 L +ADEVF+SGTAA+ITPV+ ++ +G R PIT++++ + T TE++ Sbjct: 245 ESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPITKRIQQAFFGLFTGETEDK 300 Lambda K H 0.320 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 309 Length adjustment: 27 Effective length of query: 278 Effective length of database: 282 Effective search space: 78396 Effective search space used: 78396 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory