Align N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) (characterized)
to candidate BWI76_RS00845 BWI76_RS00845 N-acetyl-gamma-glutamyl-phosphate reductase
Query= BRENDA::P11446 (334 letters) >lcl|FitnessBrowser__Koxy:BWI76_RS00845 BWI76_RS00845 N-acetyl-gamma-glutamyl-phosphate reductase Length = 334 Score = 610 bits (1572), Expect = e-179 Identities = 302/334 (90%), Positives = 312/334 (93%) Query: 1 MLNTLIVGASGYAGAELVTYVNRHPHMNITALTVSAQSNDAGKLISDLHPQLKGIVDLPL 60 MLNTLIVGASGYAGAELV YVNRHPHM ITALTVSAQSNDAGKL+SDLHPQLKGIVDLPL Sbjct: 1 MLNTLIVGASGYAGAELVAYVNRHPHMTITALTVSAQSNDAGKLVSDLHPQLKGIVDLPL 60 Query: 61 QPMSDISEFSPGVDVVFLATAHEVSHDLAPQFLEAGCVVFDLSGAFRVNDATFYEKYYGF 120 QPMSDISEFS GVDVVFLATAHEVSHDLAPQFL AGCVVFDLSGAFRVND FYEKYYGF Sbjct: 61 QPMSDISEFSAGVDVVFLATAHEVSHDLAPQFLAAGCVVFDLSGAFRVNDGAFYEKYYGF 120 Query: 121 THQYPELLEQAAYGLAEWCGNKLKEANLIAVPGCYPTAAQLALKPLIDADLLDLNQWPVI 180 THQ+PELLEQA YGLAEW KLKEANLIAVPGCYPTAAQL+LKPLIDA LLDLNQWPVI Sbjct: 121 THQHPELLEQAVYGLAEWSVEKLKEANLIAVPGCYPTAAQLSLKPLIDAGLLDLNQWPVI 180 Query: 181 NATSGVSGAGRKAAISNSFCEVSLQPYGVFTHRHQPEIATHLGADVIFTPHLGNFPRGIL 240 NATSGVSGAGRKA+I NSFCEVSLQPYGVF HRH PEI+THLGADVIFTPHLGNF RGIL Sbjct: 181 NATSGVSGAGRKASIGNSFCEVSLQPYGVFNHRHHPEISTHLGADVIFTPHLGNFKRGIL 240 Query: 241 ETITCRLKSGVTQAQVAQVLQQAYAHKPLVRLYDKGVPALKNVVGLPFCDIGFAVQGEHL 300 ETITCRLK GV++ QVA V QQAYA KPLVRLYDKGVPALKNVVGLPFCDIGFAVQ EH+ Sbjct: 241 ETITCRLKPGVSKEQVAAVFQQAYADKPLVRLYDKGVPALKNVVGLPFCDIGFAVQDEHI 300 Query: 301 IIVATEDNLLKGAAAQAVQCANIRFGYAETQSLI 334 I+VA EDNLLKGAAAQAVQCANIRFG+AETQSLI Sbjct: 301 IVVAAEDNLLKGAAAQAVQCANIRFGFAETQSLI 334 Lambda K H 0.321 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 560 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 334 Length adjustment: 28 Effective length of query: 306 Effective length of database: 306 Effective search space: 93636 Effective search space used: 93636 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate BWI76_RS00845 BWI76_RS00845 (N-acetyl-gamma-glutamyl-phosphate reductase)
to HMM TIGR01850 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01850.hmm # target sequence database: /tmp/gapView.25431.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01850 [M=345] Accession: TIGR01850 Description: argC: N-acetyl-gamma-glutamyl-phosphate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-130 420.9 0.0 2.3e-130 420.7 0.0 1.0 1 lcl|FitnessBrowser__Koxy:BWI76_RS00845 BWI76_RS00845 N-acetyl-gamma-glu Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Koxy:BWI76_RS00845 BWI76_RS00845 N-acetyl-gamma-glutamyl-phosphate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 420.7 0.0 2.3e-130 2.3e-130 2 338 .. 3 333 .. 2 334 .] 0.98 Alignments for each domain: == domain 1 score: 420.7 bits; conditional E-value: 2.3e-130 TIGR01850 2 kvaivGasGYtGaeLlrllakHpevevtklvssre...agkklsevhphlkglvdlkleelee.eeileea 68 ++ ivGasGY+GaeL+ ++++Hp++++t+l++s + agk +s++hp+lkg+vdl l+++++ +e+++ + lcl|FitnessBrowser__Koxy:BWI76_RS00845 3 NTLIVGASGYAGAELVAYVNRHPHMTITALTVSAQsndAGKLVSDLHPQLKGIVDLPLQPMSDiSEFSAGV 73 578*************************9888877789**********************999999***** PP TIGR01850 69 dvvflAlphgvsaelvpellekgvkvidlSadfRlkdaevYekwYgkkhekeelleeavYGlpElnreeik 139 dvvflA++h+vs++l+p++l++g++v+dlS++fR++d ++Yek+Yg++h+++elle+avYGl+E+ e++k lcl|FitnessBrowser__Koxy:BWI76_RS00845 74 DVVFLATAHEVSHDLAPQFLAAGCVVFDLSGAFRVNDGAFYEKYYGFTHQHPELLEQAVYGLAEWSVEKLK 144 *********************************************************************** PP TIGR01850 140 kaklianPGCyaTaalLalaPllkekliepks.iivdaksGvSgAGrkasekslfaevnenlkpYkvtkHr 209 +a+lia+PGCy+Taa+L+l+Pl++++l++ ++ ++++a sGvSgAGrkas ++f+ev +l+pY v++Hr lcl|FitnessBrowser__Koxy:BWI76_RS00845 145 EANLIAVPGCYPTAAQLSLKPLIDAGLLDLNQwPVINATSGVSGAGRKASIGNSFCEV--SLQPYGVFNHR 213 **********************************************************..*********** PP TIGR01850 210 HtpEieqelsklaekkvkvsftphlvpmtrGilatiyaklkkelteeelrklyeevYedepfvrvlkegel 280 H pEi+++l+ + v+ftphl +++rGil ti+++lk ++++e+++++++++Y+d+p+vr+++ + + lcl|FitnessBrowser__Koxy:BWI76_RS00845 214 HHPEISTHLG------ADVIFTPHLGNFKRGILETITCRLKPGVSKEQVAAVFQQAYADKPLVRLYD-KGV 277 **********......78************************************************9.89* PP TIGR01850 281 PstkavlgsnfvdigvavdeetkrvvvvsaiDNLvKGaagqAvqnlNlmlgfdetegL 338 P++k+v+g f+dig+av++ ++++vv+a DNL+KGaa+qAvq+ N+++gf+et++L lcl|FitnessBrowser__Koxy:BWI76_RS00845 278 PALKNVVGLPFCDIGFAVQD--EHIIVVAAEDNLLKGAAAQAVQCANIRFGFAETQSL 333 *******************9..8********************************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (345 nodes) Target sequences: 1 (334 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.37 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory