Align D-3-phosphoglycerate dehydrogenase; PGDH; EC 1.1.1.95; 2-oxoglutarate reductase; EC 1.1.1.399 (uncharacterized)
to candidate BWI76_RS26960 BWI76_RS26960 bifunctional glyoxylate/hydroxypyruvate reductase B
Query= curated2:P35136 (525 letters) >FitnessBrowser__Koxy:BWI76_RS26960 Length = 323 Score = 158 bits (400), Expect = 2e-43 Identities = 101/307 (32%), Positives = 157/307 (51%), Gaps = 9/307 (2%) Query: 13 DGLQPLIESDFIEIVQKNVADAEDELHTF---DAL-LVRSATKVTEDLFNKMTSLKIVGR 68 D LQ +E F KN+ H +A+ L+ S+ KV L KM L+ Sbjct: 13 DDLQQRLEQHFTVTQVKNLRPETVSQHAAAFAEAVGLLGSSEKVDTALLEKMPKLRATST 72 Query: 69 AGVGVDNIDIDEATKHGVIVINAPNGNTISTAEHTFAMISSLMRHIPQANISVKSREWNR 128 VG DN D+D V++++ P T + A+ A++ S R + + VK+ EW + Sbjct: 73 ISVGYDNFDVDALNARKVLLMHTPTVLTETVADTVMALVLSTARRVVEVANRVKAGEWTK 132 Query: 129 TA---YVGSELYGKTLGIVGLGRIGSEIAQRARA-FGMTVHVFDPFLTEERAKKIGVNSR 184 + + G++++ KTLGIVG+GRIG +AQRA A FGM + + ++ Sbjct: 133 SIGPDWFGNDVHHKTLGIVGMGRIGMALAQRAHAGFGMPILYNARRQHPQAEERFNARYC 192 Query: 185 TFEEVLESADIITVHTPLTKETKGLLNKETIAKTKKGVRLINCARGGIIDEAALLEALEN 244 + +L+ AD + + PLT+ET L K AK K IN RG ++DE AL+ AL+ Sbjct: 193 DLDTLLQEADFVCLILPLTEETHHLFGKAQFAKMKSSAIFINAGRGPVVDEKALIAALQE 252 Query: 245 GHVAGAALDVFEVEP-PVDNKLVDHPLVIATPHLGASTKEAQLNVAAQVSEEVLQFAKGL 303 G + A LDVFE EP D+ L+ P V+A PH+G++T E + N+AA + ++ G Sbjct: 253 GEIYAAGLDVFEQEPLAKDSPLLSMPNVVALPHIGSATHETRYNMAACAVDNLIDALNGS 312 Query: 304 PVMSAIN 310 + +N Sbjct: 313 VEKNCVN 319 Lambda K H 0.317 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 525 Length of database: 323 Length adjustment: 31 Effective length of query: 494 Effective length of database: 292 Effective search space: 144248 Effective search space used: 144248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory