Align phosphoserine phosphatase (EC 3.1.3.3) (characterized)
to candidate BWI76_RS13025 BWI76_RS13025 histidine phosphatase family protein
Query= BRENDA::D3DFG8 (211 letters) >FitnessBrowser__Koxy:BWI76_RS13025 Length = 206 Score = 88.2 bits (217), Expect = 1e-22 Identities = 65/202 (32%), Positives = 98/202 (48%), Gaps = 3/202 (1%) Query: 2 VKLILVRHAESEWNPVGRYQGLLDPDLSERGKKQAKLL--AQELSREHLDVIYSSPLKRT 59 +KLILVRHAE+EWN G QG D L+ RG ++ +L A S ++ +Y+SPL R Sbjct: 1 MKLILVRHAETEWNLEGIIQGHSDSSLTCRGLRETSVLLAAFSASEYQIERVYASPLGRA 60 Query: 60 YLTALEIAEAKNLEVIKEDRIIEIDHGMWSGMLVEEVMEKYPEDFRRWVEEPHKVEFQGG 119 + +AE + + E + E G + GM +E + +K+P + GG Sbjct: 61 WQMGQSLAEHFHCSLTAEPALKEQAFGQFEGMPLELLRQKHPNYANALFRLDAEYCPPGG 120 Query: 120 ESLASVYNRVKGFLEEVR-KRHWNQTVVVVSHTVPMRAMYCALLGVDLSKFWSFGCDNAS 178 ESLA RV FL+ + QT+ +VSH + L ++ F + +AS Sbjct: 121 ESLAHASQRVMRFLQNLEDTSSHQQTICIVSHGHVSQGTLAILKEGTVNSFPRYAHPHAS 180 Query: 179 YSVIHMEERRNVILKLNITCHL 200 YSVI + + + LK I HL Sbjct: 181 YSVIDLINGKCIGLKWGIATHL 202 Lambda K H 0.320 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 120 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 211 Length of database: 206 Length adjustment: 21 Effective length of query: 190 Effective length of database: 185 Effective search space: 35150 Effective search space used: 35150 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory