Align putative bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase (EC 3.5.4.19; EC 3.6.1.31) (characterized)
to candidate 201224 SO2067 phosphoribosyl-ATP pyrophosphatase/phosphoribosyl-AMP cyclohydrolase (NCBI ptt file)
Query= metacyc::HISTCYCLOPRATPPHOS (203 letters) >FitnessBrowser__MR1:201224 Length = 211 Score = 254 bits (649), Expect = 8e-73 Identities = 129/202 (63%), Positives = 156/202 (77%), Gaps = 3/202 (1%) Query: 3 TEQQRRELDWEKTDGLMPVIVQHAVSGEVLMLGYMNPEALDKTLESGKVTFFSRTKQRLW 62 T+ ELDW+K DGL+P ++Q+ +SG+VLMLGYM+ AL++TL +G VTFFSR+KQRLW Sbjct: 7 TKSDFSELDWDKQDGLIPAVIQNHLSGKVLMLGYMDKAALEQTLATGDVTFFSRSKQRLW 66 Query: 63 TKGETSGNFLNVVSIAPDCDNDTLLVLANPIGPTCHKGTSSCFGD-TAHQWLFLYQLEQL 121 TKGETSG+ L +V+I DCDND+LLV P GPTCHKGT SC+ D AH FL L +L Sbjct: 67 TKGETSGHTLKLVAIDKDCDNDSLLVQVLPNGPTCHKGTESCWLDGNAHP--FLNNLAEL 124 Query: 122 LAERKSADPETSYTAKLYASGTKRIAQKVGEEGVETALAATVHDRFELTNEASDLMYHLL 181 +A RK PE+SYTA L+A GTKRIAQKVGEEG+ETALAA HD+ EL NEASDLMYHLL Sbjct: 125 IASRKGQSPESSYTASLFARGTKRIAQKVGEEGLETALAAATHDKEELVNEASDLMYHLL 184 Query: 182 VLLQDQGLDLTTVIENLRKRHQ 203 VLL+DQ L L+ + NL RHQ Sbjct: 185 VLLEDQALSLSDITANLLARHQ 206 Lambda K H 0.317 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 203 Length of database: 211 Length adjustment: 21 Effective length of query: 182 Effective length of database: 190 Effective search space: 34580 Effective search space used: 34580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 45 (21.9 bits)
Align candidate 201224 SO2067 (phosphoribosyl-ATP pyrophosphatase/phosphoribosyl-AMP cyclohydrolase (NCBI ptt file))
to HMM TIGR03188 (hisE: phosphoribosyl-ATP diphosphatase (EC 3.6.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03188.hmm # target sequence database: /tmp/gapView.2017.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03188 [M=84] Accession: TIGR03188 Description: histidine_hisI: phosphoribosyl-ATP diphosphatase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-34 103.3 0.3 4.5e-34 102.8 0.3 1.2 1 lcl|FitnessBrowser__MR1:201224 SO2067 phosphoribosyl-ATP pyroph Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__MR1:201224 SO2067 phosphoribosyl-ATP pyrophosphatase/phosphoribosyl-AMP cyclohydrolase (NCBI ptt # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 102.8 0.3 4.5e-34 4.5e-34 1 84 [] 118 201 .. 118 201 .. 0.98 Alignments for each domain: == domain 1 score: 102.8 bits; conditional E-value: 4.5e-34 TIGR03188 1 leeLeevieerkeedpeeSytakllekgedkilkKvgEEavEviiaaknedkeelveEaaDllYhllVllaekgvsled 79 l++L+e+i++rk ++pe+Syta+l+++g+++i++KvgEE E+++aa ++dkeelv+Ea+Dl+YhllVll+++ +sl+d lcl|FitnessBrowser__MR1:201224 118 LNNLAELIASRKGQSPESSYTASLFARGTKRIAQKVGEEGLETALAAATHDKEELVNEASDLMYHLLVLLEDQALSLSD 196 689**************************************************************************** PP TIGR03188 80 vlaeL 84 ++a+L lcl|FitnessBrowser__MR1:201224 197 ITANL 201 *9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (84 nodes) Target sequences: 1 (211 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 5.22 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory