Align Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 (characterized)
to candidate 202188 SO3070 aspartate semialdehyde dehydrogenese (NCBI ptt file)
Query= SwissProt::P23247 (337 letters) >lcl|FitnessBrowser__MR1:202188 SO3070 aspartate semialdehyde dehydrogenese (NCBI ptt file) Length = 338 Score = 482 bits (1240), Expect = e-141 Identities = 236/338 (69%), Positives = 271/338 (80%), Gaps = 1/338 (0%) Query: 1 MSQQFNVAIFGATGAVGETMLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVE 60 MSQ+FNV + GA+GAVG+TM+E+L+ER FPV L+ LAS RS G+T F+GK + + +VE Sbjct: 1 MSQEFNVVVLGASGAVGQTMIEILEERNFPVANLYPLASSRSAGETVSFHGKQITILDVE 60 Query: 61 EFDWSQVHIALFSAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIAE 120 FDWSQ + FSAGG++SAKWAPIAAEAG VVIDNTSHFRYD DIPLVVPEVNP AIA+ Sbjct: 61 TFDWSQAQLGFFSAGGDVSAKWAPIAAEAGCVVIDNTSHFRYDIDIPLVVPEVNPHAIAD 120 Query: 121 FRNRNIIANPNCSTIQMLVALKPIYDAVGIERINVTTYQSVSGAGKAGIDELAGQTAKLL 180 FRNRNIIANPNCSTIQMLVALKPIYD GI RINV TYQSVSG GK I+ELA Q KLL Sbjct: 121 FRNRNIIANPNCSTIQMLVALKPIYDTYGISRINVATYQSVSGTGKKAIEELARQCTKLL 180 Query: 181 NGYPAETNTFSQQIAFNCIPQIDQFMDNGYTKEEMKMVWETQKIFNDPSIMVNPTCVRVP 240 G PAE + +QIAFN +PQID+FMDNGYTKEEMKMVWETQKIF D I+VN T VRVP Sbjct: 181 QGLPAEAEVYPKQIAFNVLPQIDKFMDNGYTKEEMKMVWETQKIFGDDDILVNATAVRVP 240 Query: 241 VFYGHAEAVHVETRAPIDAEQVMDMLEQTDGIELFRGAD-FPTQVRDAGGKDHVLVGRVR 299 VFYGH+EAVH+ETR P DAE + +L +G+ LF D +PT V A G D V VGRVR Sbjct: 241 VFYGHSEAVHIETRQPADAEDIKALLRNAEGVVLFESDDEYPTAVTHAAGTDPVYVGRVR 300 Query: 300 NDISHHSGINLWVVADNVRKGAATNAVQIAELLVRDYF 337 DISH GINLWVV+DN+RKGAA N+VQIAE+LVRDY+ Sbjct: 301 KDISHAHGINLWVVSDNIRKGAALNSVQIAEILVRDYY 338 Lambda K H 0.319 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 338 Length adjustment: 28 Effective length of query: 309 Effective length of database: 310 Effective search space: 95790 Effective search space used: 95790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate 202188 SO3070 (aspartate semialdehyde dehydrogenese (NCBI ptt file))
to HMM TIGR01296 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01296.hmm # target sequence database: /tmp/gapView.28125.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01296 [M=339] Accession: TIGR01296 Description: asd_B: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-137 444.3 0.1 1.6e-137 444.1 0.1 1.0 1 lcl|FitnessBrowser__MR1:202188 SO3070 aspartate semialdehyde de Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__MR1:202188 SO3070 aspartate semialdehyde dehydrogenese (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 444.1 0.1 1.6e-137 1.6e-137 1 338 [. 6 335 .. 6 336 .. 0.98 Alignments for each domain: == domain 1 score: 444.1 bits; conditional E-value: 1.6e-137 TIGR01296 1 nvaivGatGavGqellkvLeernfpidklvllasersaGkkvkfkgkeleveeaekesfegidialfsaGgsvskefap 79 nv ++Ga+GavGq+++++Leernfp+ +l++las+rsaG+ v f+gk++++ ++e+++ ++ ++ +fsaGg vs ++ap lcl|FitnessBrowser__MR1:202188 6 NVVVLGASGAVGQTMIEILEERNFPVANLYPLASSRSAGETVSFHGKQITILDVETFDWSQAQLGFFSAGGDVSAKWAP 84 689**************************************************************************** PP TIGR01296 80 kaakagviviDntsafrldedvPLvvpevnaeelkeakkkgiianPnCstiqlvvvLkplkdeaklkrvvvstYqavsG 158 aa+ag++viDnts fr d d+PLvvpevn + ++++++++iianPnCstiq++v+Lkp++d +++ r+ v+tYq+vsG lcl|FitnessBrowser__MR1:202188 85 IAAEAGCVVIDNTSHFRYDIDIPLVVPEVNPHAIADFRNRNIIANPNCSTIQMLVALKPIYDTYGISRINVATYQSVSG 163 ******************************************************************************* PP TIGR01296 159 aGkkgveeLknqtkavlegkekepeidalkakkfakqiafnaiplidklkedGytkeelkllfetrkilgiedlkvsat 237 +Gkk++eeL+ q l+g e a+ ++kqiafn++p+idk++++Gytkee+k+++et+ki+g++d+ v at lcl|FitnessBrowser__MR1:202188 164 TGKKAIEELARQCTKLLQGLPAE-------AEVYPKQIAFNVLPQIDKFMDNGYTKEEMKMVWETQKIFGDDDILVNAT 235 ************99999987766.......799********************************************** PP TIGR01296 238 cvrvPvftghsesvsiefekelsveevkelLkeapgvvviddpsenlyptPl.eavgkdevfvgrirkDlskekglalf 315 +vrvPvf+ghse+v+ie+ +++++e++k lL++a+gvv+ + + ++ypt + +a+g+d v+vgr+rkD+s+++g++l+ lcl|FitnessBrowser__MR1:202188 236 AVRVPVFYGHSEAVHIETRQPADAEDIKALLRNAEGVVLFESD--DEYPTAVtHAAGTDPVYVGRVRKDISHAHGINLW 312 ***************************************9977..89**9973699*********************** PP TIGR01296 316 vvaDnlrkGaalnavqiaellik 338 vv+Dn+rkGaaln+vqiae l++ lcl|FitnessBrowser__MR1:202188 313 VVSDNIRKGAALNSVQIAEILVR 335 ********************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (339 nodes) Target sequences: 1 (338 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 11.83 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory