Align Arogenate dehydratase 1; PhADT1; EC 4.2.1.91 (characterized)
to candidate 200542 SO1367 chorismate mutase/prephenate dehydratase (NCBI ptt file)
Query= SwissProt::D3U715 (424 letters) >FitnessBrowser__MR1:200542 Length = 671 Score = 146 bits (369), Expect = 2e-39 Identities = 92/292 (31%), Positives = 148/292 (50%), Gaps = 21/292 (7%) Query: 132 VAYQGVPGAYSEAAAGKAYPNCEA----IPCDQFEVAFQAVELWIADRAVLPVENSLGGS 187 +AY G G+YS AA + + + C F+ QAVE AD LP+EN+ GS Sbjct: 107 IAYLGARGSYSYLAASRYCQRRQVEMLDLGCQSFDEIVQAVESGHADYGFLPIENTSSGS 166 Query: 188 IHRNYDLLLRHRLHIVGEVQLPVHHCLLALPGVRKEYLTRVISHPQALAQCELTITKLGL 247 I+ YD+L L IVGE + V HCLL PG + + V +HPQ ++QC +++ Sbjct: 167 INEVYDVLQHTSLSIVGETTIEVSHCLLGKPGSKLSEIKTVYAHPQPISQCSRYLSQ-HK 225 Query: 248 NVAREAVDDTAGAAEYIAANNLRDTAAVASARAAELYGLQILAEGIQDDSSNVTRFVMLA 307 + E +A A E + + AA+ SA LY L+ + G+ + N +RF+++A Sbjct: 226 ALRLEYCSSSAEAMEKVNQSPDNSAAAIGSAEGGALYQLESIESGLANQKINQSRFIVVA 285 Query: 308 REPIIPRMDRPFKTSIVFA-HEGTGVLFKVLSAFAFRNISLTKIESRPHRNRPIRLVDDA 366 R+ + P KT+++ A + G L + L ++++K+ESRP P Sbjct: 286 RKAVAVPEQLPAKTTLIMATGQKAGALVEALLVLKAHQLNMSKLESRPIPGTP------- 338 Query: 367 NVGTAKHFEYMFYVDFDASMADVRAQNALAEVQEFTSFLRVLGSYPMD-MTP 417 +E MFY+D DA+++ Q L +++ T F++VLG YP + +TP Sbjct: 339 -------WEEMFYLDIDANISSEAMQQGLKQLERITRFIKVLGCYPCETVTP 383 Lambda K H 0.319 0.133 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 488 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 424 Length of database: 671 Length adjustment: 35 Effective length of query: 389 Effective length of database: 636 Effective search space: 247404 Effective search space used: 247404 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory