Align glutamate N-acetyltransferase/amino-acid acetyltransferase; EC 2.3.1.35 2.3.1.1 (characterized)
to candidate GFF593 HP15_576 bifunctional ornithine acetyltransferase/N-acetylglutamate synthase protein
Query= CharProtDB::CH_000559 (406 letters) >FitnessBrowser__Marino:GFF593 Length = 405 Score = 393 bits (1010), Expect = e-114 Identities = 212/403 (52%), Positives = 276/403 (68%), Gaps = 9/403 (2%) Query: 9 TAEQLPDIDGIALYTAQAGVKKPGHTDLTLIAVAAGSTVGAVFTTNRFCAAPVHIAKSHL 68 T + + GI + A AG+KKPG D+ + +A S V +FT N+FCAAPV +++ HL Sbjct: 7 TLPEFYPVAGIKVGIASAGIKKPGRKDVVVFELAPESRVAGIFTKNQFCAAPVTLSRRHL 66 Query: 69 FDEDGVRALVINTGNANAGTGAQGRIDALAVCAAAARQIGCKPNQVMPFSTGVILEPLPA 128 E R L+INTGNANAGTG QG DA+A C A A+Q G +++PFSTGVI EPLP Sbjct: 67 A-ETSPRYLLINTGNANAGTGEQGMRDAMACCQALAKQAGVTEAEILPFSTGVIGEPLPV 125 Query: 129 DKIIAALPKMQPAF----WNEAARAIMTTDTVPKAASREGKVG-DQHTVRATGIAKGSGM 183 KI+ ALP+ W EAA IMTTDT PK AS + VG D HTV +GI+KG+GM Sbjct: 126 QKIVGALPEALANTAENRWTEAASGIMTTDTRPKGASCQ--VGLDGHTVTISGISKGAGM 183 Query: 184 IHPNMATMLGFIATDAKVSQPVLQLMTQEIADETFNTITVDGDTSTNDSFVIIATGKNSQ 243 I PNMATMLGFIATDA+++ +LQ + E+ +++FN IT+DGDTSTND+ +++A+G+ S Sbjct: 184 IRPNMATMLGFIATDARIAPELLQTLASELGEKSFNRITIDGDTSTNDACMLMASGQYSG 243 Query: 244 SEIDNIADPRYAQLKELLCSLALELAQAIVRDGEGATKFITVRVENAKTCDEARQAAYAA 303 EI + +L+E L ++ LELA AIVRDGEGATKF+T+ V A EA AY Sbjct: 244 PEI-TASSAALPKLREALQAIYLELAHAIVRDGEGATKFVTIDVSGAAGQQEALDVAYTV 302 Query: 304 ARSPLVKTAFFASDPNLGKRLAAIGYADVADLDTDLVEMYLDDILVAEHGGRAASYTEAQ 363 A SPLVKTA FASDPN G+ LAA+G A V LD + +E+YL D+ + +GGRA Y+EA+ Sbjct: 303 AHSPLVKTALFASDPNWGRILAAVGRAGVEGLDLNALEIYLGDVCLVRNGGRAEDYSEAR 362 Query: 364 GQAVMSKDEITVRIKLHRGQAAATVYTCDLSHGYVSINADYRS 406 GQAVM ++EIT+ I L RG TV+TCD SH YV+INA+YR+ Sbjct: 363 GQAVMDREEITIAIDLKRGDVRETVWTCDFSHDYVTINAEYRT 405 Lambda K H 0.317 0.130 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 383 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 405 Length adjustment: 31 Effective length of query: 375 Effective length of database: 374 Effective search space: 140250 Effective search space used: 140250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory