Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EPSP phospholyase; EC 4.2.3.5 (characterized)
to candidate GFF1881 HP15_1838 chorismate synthase
Query= SwissProt::P12008 (361 letters) >FitnessBrowser__Marino:GFF1881 Length = 364 Score = 523 bits (1347), Expect = e-153 Identities = 252/359 (70%), Positives = 301/359 (83%) Query: 1 MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDLDRRRPGTSRYTTQRR 60 M+GN+ G+LF VT+FGESHG ALGCI+DG PPG+ L+EAD+Q DLDRR+PGTSR+TTQRR Sbjct: 1 MSGNSFGKLFTVTSFGESHGPALGCIIDGCPPGLELSEADMQRDLDRRKPGTSRHTTQRR 60 Query: 61 EPDQVKILSGVFEGVTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGLRDY 120 E D+V+ILSGVFEG TTGT IGLLIENTDQRS+DYS I + FRP HADYTY KYG+RDY Sbjct: 61 EADEVRILSGVFEGKTTGTPIGLLIENTDQRSKDYSKISEQFRPAHADYTYMHKYGVRDY 120 Query: 121 RGGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDIPLDIKDWSQVEQNPFFC 180 RGGGRSSARETAMRVAAGA+A+K+L ++ GI IRG L+Q+G I + DW QV QNPFFC Sbjct: 121 RGGGRSSARETAMRVAAGAVARKFLEQRLGIRIRGYLSQLGPIKAEKLDWDQVHQNPFFC 180 Query: 181 PDPDKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRLDADIAHALMSINAV 240 PD DK+ ++ M AL+KEGDSIGA++ VVA GVP GLGEP+FDRLDAD+AHALMSINAV Sbjct: 181 PDADKVPEMEAYMDALRKEGDSIGARINVVADGVPPGLGEPIFDRLDADLAHALMSINAV 240 Query: 241 KGVEIGDGFDVVALRGSQNRDEITKDGFQSNHAGGILGGISSGQQIIAHMALKPTSSITV 300 KGVEIG GFD + +G+++RDE+T +GF SN+AGG+LGGISSGQ I+A +ALKPTSS+ + Sbjct: 241 KGVEIGAGFDCIDQKGTEHRDEMTPEGFLSNNAGGVLGGISSGQPIVASIALKPTSSLRL 300 Query: 301 PGRTINRFGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRQRAQNADVKTDIP 359 GR+I+ G+ E+IT GRHDPCVGIRA PIAEAM+AIVLMDH LR R QNADV P Sbjct: 301 SGRSIDVNGDPCEVITTGRHDPCVGIRATPIAEAMMAIVLMDHYLRHRGQNADVSVSTP 359 Lambda K H 0.319 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 474 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 364 Length adjustment: 29 Effective length of query: 332 Effective length of database: 335 Effective search space: 111220 Effective search space used: 111220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate GFF1881 HP15_1838 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.15149.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-145 469.2 0.0 4.3e-145 469.0 0.0 1.0 1 lcl|FitnessBrowser__Marino:GFF1881 HP15_1838 chorismate synthase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Marino:GFF1881 HP15_1838 chorismate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 469.0 0.0 4.3e-145 4.3e-145 1 350 [. 10 350 .. 10 351 .. 0.98 Alignments for each domain: == domain 1 score: 469.0 bits; conditional E-value: 4.3e-145 TIGR00033 1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtGaPiall 75 +++t fGeSHg+alg+iidG+P+glel+e+d+q++l+rR+pg+sr+t++r+E+Dev+ilsGvfeGkTtG+Pi ll lcl|FitnessBrowser__Marino:GFF1881 10 FTVTSFGESHGPALGCIIDGCPPGLELSEADMQRDLDRRKPGTSRHTTQRREADEVRILSGVFEGKTTGTPIGLL 84 789************************************************************************ PP TIGR00033 76 ikNkdvrskdyedikelpRPgHadytylkKYgikdregggrsSaReTaarvaaGavakklLketagieivayvvk 150 i+N+d+rskdy++i+e++RP+Hadyty++KYg++d++gggrsSaReTa+rvaaGava+k+L++ gi+i +y+++ lcl|FitnessBrowser__Marino:GFF1881 85 IENTDQRSKDYSKISEQFRPAHADYTYMHKYGVRDYRGGGRSSARETAMRVAAGAVARKFLEQRLGIRIRGYLSQ 159 *************************************************************************** PP TIGR00033 151 lgeveleeesakeiskerldkspvrcpdaeaekemeeeidkakkdgdsvGgvvevvvsnvpvglGeplfdkldae 225 lg +++e+ ++++++p++cpda++ eme+++d ++k+gds+G++++vv+ +vp glGep+fd+lda lcl|FitnessBrowser__Marino:GFF1881 160 LGPIKAEKLDW-----DQVHQNPFFCPDADKVPEMEAYMDALRKEGDSIGARINVVADGVPPGLGEPIFDRLDAD 229 *****997444.....579******************************************************** PP TIGR00033 226 lasallsinAvKgveiGdGFeaasvrGseanDelvleddkirrktnnsGGieGGitnGedirvriavKpiptikk 300 la+al+sinAvKgveiG+GF+ ++G e+ De++ e + +nn GG++GGi+ G++i+ +ia+Kp+++++ lcl|FitnessBrowser__Marino:GFF1881 230 LAHALMSINAVKGVEIGAGFDCIDQKGTEHRDEMTPE----GFLSNNAGGVLGGISSGQPIVASIALKPTSSLRL 300 ********************************88654....69******************************** PP TIGR00033 301 plktvdletkekakatkgRhDpcvvpravpvvEamvalvladallekras 350 +++d+++ + +t+gRhDpcv +ra+p++Eam+a+vl+d++l++r++ lcl|FitnessBrowser__Marino:GFF1881 301 SGRSIDVNGDPCEVITTGRHDPCVGIRATPIAEAMMAIVLMDHYLRHRGQ 350 ***********************************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (364 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.22 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory