Align Cysteine synthase B; CSase B; O-acetylserine (thiol)-lyase B; OAS-TL B; O-acetylserine sulfhydrylase B; EC 2.5.1.47 (characterized)
to candidate GFF810 HP15_789 cysteine synthase B
Query= SwissProt::P16703 (303 letters) >FitnessBrowser__Marino:GFF810 Length = 297 Score = 416 bits (1070), Expect = e-121 Identities = 199/290 (68%), Positives = 248/290 (85%) Query: 3 TLEQTIGNTPLVKLQRMGPDNGSEVWLKLEGNNPAGSVKDRAALSMIVEAEKRGEIKPGD 62 T+E +G+TPLV+LQR+ + + + KLEGNNPAGSVKDR A+SMI EAE+RG+IKPGD Sbjct: 5 TIEDYVGHTPLVRLQRLPGETSNVILAKLEGNNPAGSVKDRPAISMIQEAERRGDIKPGD 64 Query: 63 VLIEATSGNTGIALAMIAALKGYRMKLLMPDNMSQERRAAMRAYGAELILVTKEQGMEGA 122 LIEATSGNTGIALAM AA+KGYRM L+MP NMS+ERRA+MRAYGAE++ VT+E+GME A Sbjct: 65 TLIEATSGNTGIALAMAAAIKGYRMVLIMPANMSEERRASMRAYGAEIVTVTREEGMETA 124 Query: 123 RDLALEMANRGEGKLLDQFNNPDNPYAHYTTTGPEIWQQTGGRITHFVSSMGTTGTITGV 182 RDLAL+M G+G +LDQF+N DNP AHY TTGPEIW+QTGGR+THFVSSMGTTGTI GV Sbjct: 125 RDLALKMQAEGKGTVLDQFSNQDNPLAHYRTTGPEIWEQTGGRVTHFVSSMGTTGTIMGV 184 Query: 183 SRFMREQSKPVTIVGLQPEEGSSIPGIRRWPTEYLPGIFNASLVDEVLDIHQRDAENTMR 242 SR+++E++ + I+GLQP+EG+SIPGIRRWP YLP I++A+ VD+VLD+ Q +AE TMR Sbjct: 185 SRYLKERNPDIRIIGLQPKEGASIPGIRRWPEAYLPKIYDAARVDQVLDVGQEEAETTMR 244 Query: 243 ELAVREGIFCGVSSGGAVAGALRVAKANPDAVVVAIICDRGDRYLSTGVF 292 LA EGIFCGVSSGG++A AL++++ +A++VAIICDRGDRYLSTGVF Sbjct: 245 ALASEEGIFCGVSSGGSIAAALKLSQQVENAIIVAIICDRGDRYLSTGVF 294 Lambda K H 0.316 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 297 Length adjustment: 27 Effective length of query: 276 Effective length of database: 270 Effective search space: 74520 Effective search space used: 74520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate GFF810 HP15_789 (cysteine synthase B)
to HMM TIGR01138 (cysM: cysteine synthase B (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01138.hmm # target sequence database: /tmp/gapView.18689.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01138 [M=290] Accession: TIGR01138 Description: cysM: cysteine synthase B Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-155 502.2 0.3 3e-155 502.0 0.3 1.0 1 lcl|FitnessBrowser__Marino:GFF810 HP15_789 cysteine synthase B Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Marino:GFF810 HP15_789 cysteine synthase B # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 502.0 0.3 3e-155 3e-155 1 290 [] 5 294 .. 5 294 .. 1.00 Alignments for each domain: == domain 1 score: 502.0 bits; conditional E-value: 3e-155 TIGR01138 1 tilklvGntplvrlkrllpeedsevlvklegnnpaGsvkdrpalsmiveaekrGeikeGdvlieatsGntGialam 76 ti++ vG tplvrl+rl++e+++ +l+klegnnpaGsvkdrpa+smi eae+rG+ik+Gd+lieatsGntGialam lcl|FitnessBrowser__Marino:GFF810 5 TIEDYVGHTPLVRLQRLPGETSNVILAKLEGNNPAGSVKDRPAISMIQEAERRGDIKPGDTLIEATSGNTGIALAM 80 89************************************************************************** PP TIGR01138 77 vaalkGykvkllmpdnvseerkaalkayGaelilvdkeeGmeGardlarelvrkgeeklldqfnnpdnpkahytst 152 +aa+kGy++ l+mp+n+seer+a ++ayGae++ v++eeGme ardla +++ +g++ +ldqf+n dnp ahy +t lcl|FitnessBrowser__Marino:GFF810 81 AAAIKGYRMVLIMPANMSEERRASMRAYGAEIVTVTREEGMETARDLALKMQAEGKGTVLDQFSNQDNPLAHYRTT 156 **************************************************************************** PP TIGR01138 153 GieiwqqtkGrithfvsslGttGtimGvsrflkeqnpavqivGlqpaegsaieGlrrieseylpgifdaslvdrvv 228 G+eiw+qt+Gr+thfvss+GttGtimGvsr+lke+np+++i+Glqp+eg +i+G+rr+++ ylp+i+da++vd+v+ lcl|FitnessBrowser__Marino:GFF810 157 GPEIWEQTGGRVTHFVSSMGTTGTIMGVSRYLKERNPDIRIIGLQPKEGASIPGIRRWPEAYLPKIYDAARVDQVL 232 **************************************************************************** PP TIGR01138 229 dveqedaediarelakkegifvGvssGgavaaalrlarelekavvvaiicdrGdrylstgvf 290 dv qe+ae ++r la +egif+GvssGg++aaal+l++++e+a++vaiicdrGdrylstgvf lcl|FitnessBrowser__Marino:GFF810 233 DVGQEEAETTMRALASEEGIFCGVSSGGSIAAALKLSQQVENAIIVAIICDRGDRYLSTGVF 294 *************************************************************8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (290 nodes) Target sequences: 1 (297 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.96 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory