Align Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase III; GSIII; EC 6.3.1.2 (characterized)
to candidate GFF3214 HP15_3156 glutamate-ammonia ligase
Query= SwissProt::O87393 (435 letters) >FitnessBrowser__Marino:GFF3214 Length = 452 Score = 301 bits (771), Expect = 3e-86 Identities = 168/432 (38%), Positives = 244/432 (56%), Gaps = 17/432 (3%) Query: 11 EKGVKYFMISYTDLFGGQRAKLVPAEAIADMQKGGAGFAGFATWFDLTP---AHPDLFAL 67 E+GVKY + SY D+ G + K VP + M +G + G A D P + ++ ++ Sbjct: 16 EEGVKYAIASYVDIHGVTKGKFVPVAHLGQMMEGSELYTGAA--LDGVPQDISDDEVASM 73 Query: 68 PDASAVIQLPWKKDVAWVAADCIMDDAPVEQAPRVVLKKLVAEAAQEGLRVKTGVEPEFF 127 PDA + PW + +AW + ++ P E R +L++ ++ AA G R G+E EFF Sbjct: 74 PDADGLAICPWNRQLAWFPGNLFLNGTPFEACSRNILRRQLSAAADMGYRFNLGIETEFF 133 Query: 128 LI--SPDG--SKISDTFDTAEKPCYDQQAIMRRYDVIAEICDYMLELGWKPYQNDHEDAN 183 L + DG + +SD D KPCYD + +M ++ E+ D M ELGW Y DHEDAN Sbjct: 134 LFRDTEDGGFAPLSDR-DNLGKPCYDPRTLMDNLPIMDELVDAMNELGWDVYSFDHEDAN 192 Query: 184 GQFEMNWEYDDALRTADKHSFFKFMVKSIAEKHGLRATFMPKPFKGLTGNGCHCHISVWD 243 GQFE +++Y DAL +D+ FF+ M IA KHG A+FMPKPF TG+G H ++S+ D Sbjct: 193 GQFETDFKYADALTMSDRLVFFRMMANEIARKHGAFASFMPKPFADRTGSGAHYNMSLAD 252 Query: 244 LAGEVNAF---ADNKAEFGLSAEGRHFLGGIMKHASALAAVTNPTVNSYKRINAPRTISG 300 L N F D+ G+S HF G++KH +A++AV PTVNSYKR+ ++SG Sbjct: 253 LKTGENLFEPRGDDLHNCGISKIAYHFTAGVLKHGAAISAVIAPTVNSYKRLVRQGSMSG 312 Query: 301 ATWAPNSVTWTGNNRTHMVRVPG-PGRFELRLPDGAVNPYLLQAIIIAAGLSGVRSKADP 359 +TWAP + + NNRT+M+R+PG GR E R D A NPYL A+I+AAGL G+R D Sbjct: 313 STWAPVFMCYGSNNRTNMIRIPGMGGRIECRAADIACNPYLGSALILAAGLEGIREGLDA 372 Query: 360 G--RHYDIDMYKDGHKVTDAPK-LPLNLLDALREYNRDEELQEALGREFSAAYLKLKQGE 416 G H ++ Y D + LP NL +A+ + D +E G +++ K+GE Sbjct: 373 GAPHHENMYNYSDAEIAEQGIEYLPRNLGEAVEAFEADPLAKEVFGEAMFNSFIDFKKGE 432 Query: 417 WNTYCSQFTEWE 428 W +Y + + WE Sbjct: 433 WESYQNHVSSWE 444 Lambda K H 0.319 0.135 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 502 Number of extensions: 25 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 435 Length of database: 452 Length adjustment: 32 Effective length of query: 403 Effective length of database: 420 Effective search space: 169260 Effective search space used: 169260 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate GFF3214 HP15_3156 (glutamate-ammonia ligase)
to HMM TIGR03105 (glnT: glutamine synthetase, type III (EC 6.3.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03105.hmm # target sequence database: /tmp/gapView.9072.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03105 [M=435] Accession: TIGR03105 Description: gln_synth_III: glutamine synthetase, type III Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-179 581.9 0.0 3.8e-179 581.7 0.0 1.0 1 lcl|FitnessBrowser__Marino:GFF3214 HP15_3156 glutamate-ammonia liga Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Marino:GFF3214 HP15_3156 glutamate-ammonia ligase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 581.7 0.0 3.8e-179 3.8e-179 2 434 .. 11 449 .. 10 450 .. 0.98 Alignments for each domain: == domain 1 score: 581.7 bits; conditional E-value: 3.8e-179 TIGR03105 2 kklleekgvkyvlaafvdllGvakaklvPvealdalakegagfaGfavsglglePadadllavpdldsliqlPwk 76 k+ l e+gvky +a++vd++Gv+k+k+vPv +l +++++++ ++G a++g+ + +d++++++pd+d l Pw+ lcl|FitnessBrowser__Marino:GFF3214 11 KEKLTEEGVKYAIASYVDIHGVTKGKFVPVAHLGQMMEGSELYTGAALDGVPQDISDDEVASMPDADGLAICPWN 85 678899********************************************************************* PP TIGR03105 77 pevawvaadlvvegkpvelapRvvlkkllaeaaekgftlktGveceffllrreedgklsvaDkaDklakpcYDqr 151 +++aw +++l+++g+p+e +R++l+++l+ aa++g+++++G+e+effl+r++edg+ ++ ++D+l kpcYD r lcl|FitnessBrowser__Marino:GFF3214 86 RQLAWFPGNLFLNGTPFEACSRNILRRQLSAAADMGYRFNLGIETEFFLFRDTEDGGFAPLSDRDNLGKPCYDPR 160 *************************************************************************** PP TIGR03105 152 almrrydvleeisealnelGwdlYqiDheDanGqfelnfeyaDalttaDrvaffkylvkeiaeeegllatfmPkP 226 +lm + +++e+++a+nelGwd+Y++DheDanGqfe +f+yaDalt++Dr++ff+++++eia+++g a+fmPkP lcl|FitnessBrowser__Marino:GFF3214 161 TLMDNLPIMDELVDAMNELGWDVYSFDHEDANGQFETDFKYADALTMSDRLVFFRMMANEIARKHGAFASFMPKP 235 *************************************************************************** PP TIGR03105 227 fadrtGnGlhlhlslld.edgknlfaddad.eeglglsklayhfiaGilkhakaLaallaPtvnsYkRlvakrtl 299 fadrtG+G+h+++sl+d ++g+nlf+ + d ++ g+sk+ayhf aG+lkh++a++a++aPtvnsYkRlv+++++ lcl|FitnessBrowser__Marino:GFF3214 236 FADRTGSGAHYNMSLADlKTGENLFEPRGDdLHNCGISKIAYHFTAGVLKHGAAISAVIAPTVNSYKRLVRQGSM 310 *****************999******99875899***************************************** PP TIGR03105 300 sgatWaPalisyggnnRthmvRiP.dagRlelRlaDgaanpYlvsaavlaaGLdGierkldpgkrkdenlya... 370 sg tWaP+++ yg+nnRt+m+RiP +gR+e R aD a+npYl sa++laaGL+Gi++ ld+g++++en+y+ lcl|FitnessBrowser__Marino:GFF3214 311 SGSTWAPVFMCYGSNNRTNMIRIPgMGGRIECRAADIACNPYLGSALILAAGLEGIREGLDAGAPHHENMYNysd 385 ************************5579*******************************************9998 PP TIGR03105 371 eelaekgvetLPqtLlealraleadelleealGkelveeflklkreeweeyhrtvsdWeidryl 434 +e+ae+g+e LP++L ea++a+ead+l +e++G+++ ++f+++k+ ewe+y+++vs+We+dryl lcl|FitnessBrowser__Marino:GFF3214 386 AEIAEQGIEYLPRNLGEAVEAFEADPLAKEVFGEAMFNSFIDFKKGEWESYQNHVSSWEVDRYL 449 99*************************************************************8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (435 nodes) Target sequences: 1 (452 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 11.02 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory