Align succinyldiaminopimelate transaminase (EC 2.6.1.17) (characterized)
to candidate GFF3630 HP15_3572 aminotransferase, classes I and II
Query= BRENDA::P9WPZ5 (397 letters) >FitnessBrowser__Marino:GFF3630 Length = 401 Score = 101 bits (251), Expect = 4e-26 Identities = 89/282 (31%), Positives = 124/282 (43%), Gaps = 13/282 (4%) Query: 88 VLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVP------D 141 +L+ G +I AA + PG V++ P Y + V +G + PLVP D Sbjct: 90 ILMAPGVVPSINAACMAYAGPGEGVIIQPPVYPPFFSSVRHSGRVVIENPLVPEDPDTGD 149 Query: 142 GRGFALDADALRR-AVTPRTRALIINSPHNPTGAVLSATELAAIAEIAVAANLVVITDEV 200 + +D D L A P R L++ SPHNP G V S EL A+ +IA LVV++DE+ Sbjct: 150 PGHYRMDLDHLEECAARPDARVLLLCSPHNPVGRVWSEEELRAVLDIARRHQLVVVSDEI 209 Query: 201 YEHLVF-DHARHLPLAGFDGMAERTITISSAAKMFNCTGWKIGWACGP-AELIAGVRAAK 258 + LVF D RH LA G + + + +K FN G + P AE ++A Sbjct: 210 HCDLVFPDKPRHTMLANLAGPDDALVMAVAPSKSFNMPGLGLSALVIPDAERRKAMKAVF 269 Query: 259 QYLSYVGGAPFQPA-VALALDTEDAWVAALRNSLRARRDRL--AAGLTEIGFAVHDSYGT 315 + + PF A W+ L L+A RD + A G G V GT Sbjct: 270 ESMHLPQCNPFSIAGFEAGYRHGGPWLDDLMAYLQANRDYVVEAVGQRLPGVRVSAPEGT 329 Query: 316 YFLCADPRPLGYDDSTEFCAALPEKVGVAAIPMSAFCDPAAG 357 Y + D R LG DD+ K GV P +F DP +G Sbjct: 330 YLMWLDCRELGLDDA-GLKRFFVRKAGVGMNPGLSFGDPGSG 370 Lambda K H 0.321 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 435 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 401 Length adjustment: 31 Effective length of query: 366 Effective length of database: 370 Effective search space: 135420 Effective search space used: 135420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory