Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase; Tetrahydrodipicolinate N-succinyltransferase; THDP succinyltransferase; THP succinyltransferase; Tetrahydropicolinate succinylase; EC 2.3.1.117 (characterized)
to candidate GFF1183 HP15_1160 tetrahydrodipicolinate succinylase
Query= SwissProt::G3XD76 (344 letters) >FitnessBrowser__Marino:GFF1183 Length = 342 Score = 473 bits (1218), Expect = e-138 Identities = 235/340 (69%), Positives = 279/340 (82%), Gaps = 1/340 (0%) Query: 6 FSLAFGVGTQNRQEAWLEVFYALPLLKPSSEIVAAVAPILGYAAGNQALTFTSQQAYQLA 65 F+ G+GTQN Q WLEVFY P++ P + ++ ++ L Y GNQA++ T++Q QLA Sbjct: 3 FAFGIGIGTQNNQGEWLEVFYQQPVMTPDNTLMDVISNALDYKGGNQAISATAEQLSQLA 62 Query: 66 DALKGI-DAAQSALLSRLAESQKPLVATLLAEDAAPSSTAEAYLKLHLLSHRLVKPHAVN 124 +AL+ I Q++L + A S++P+V T+L D SST E YLKLHL+SHR+ KPH + Sbjct: 63 NALRQIGQTGQASLADKAAASKRPVVVTVLETDDTASSTPEVYLKLHLISHRMAKPHGLK 122 Query: 125 LSGIFPLLPNVAWTNIGAVDLAELAELQLEARLKGKLLEVFSVDKFPKMTDYVVPAGVRI 184 L GIF LLPN+AWT+ GA+DL EL++ QL+ARL+G+ LEV SVDKFP+MTDYVVP GVRI Sbjct: 123 LDGIFGLLPNLAWTSEGAIDLNELSDRQLQARLEGRTLEVKSVDKFPQMTDYVVPKGVRI 182 Query: 185 ADTARVRLGAYIGEGTTVMHEGFVNFNAGTEGPGMIEGRVSAGVFVGKGSDLGGGCSTMG 244 ADTARVRLGAY+GEGTTVMHEGF+NFNAGTEG MIEGR+SAGV VGKGSDLGGGCSTMG Sbjct: 183 ADTARVRLGAYVGEGTTVMHEGFINFNAGTEGTSMIEGRISAGVMVGKGSDLGGGCSTMG 242 Query: 245 TLSGGGNIVISVGEGCLIGANAGIGIPLGDRNIVEAGLYITAGTKVALLDEQNALVKVVK 304 TLSGGGNI+I+VGE CLIGANAGIGIPLGDR VEAGLYITAGTKVALLD+ N LV+V+K Sbjct: 243 TLSGGGNIIIAVGENCLIGANAGIGIPLGDRCKVEAGLYITAGTKVALLDDNNELVEVIK 302 Query: 305 ARDLAGQPDLLFRRNSQNGAVECKTNKTAIELNEALHAHN 344 ARDLA Q DLLFRRNSQ GAVECKTNK+AIELNE LHA+N Sbjct: 303 ARDLANQTDLLFRRNSQTGAVECKTNKSAIELNEELHANN 342 Lambda K H 0.317 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 391 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 342 Length adjustment: 29 Effective length of query: 315 Effective length of database: 313 Effective search space: 98595 Effective search space used: 98595 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate GFF1183 HP15_1160 (tetrahydrodipicolinate succinylase)
to HMM TIGR03536 (dapD: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03536.hmm # target sequence database: /tmp/gapView.1230.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03536 [M=341] Accession: TIGR03536 Description: DapD_gpp: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-193 627.8 3.9 2.2e-193 627.6 3.9 1.0 1 lcl|FitnessBrowser__Marino:GFF1183 HP15_1160 tetrahydrodipicolinate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Marino:GFF1183 HP15_1160 tetrahydrodipicolinate succinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 627.6 3.9 2.2e-193 2.2e-193 2 341 .] 3 342 .] 2 342 .] 1.00 Alignments for each domain: == domain 1 score: 627.6 bits; conditional E-value: 2.2e-193 TIGR03536 2 lslalGvgtknrkgewlevffptpllnpdeelveavaealgyegGnqaieltaeklealaaalkeagleeqaela 76 +++++G+gt+n++gewlevf+ +p++ pd++l++++ +al+y+gGnqai+ tae+l++la+al++ g++ qa+la lcl|FitnessBrowser__Marino:GFF1183 3 FAFGIGIGTQNNQGEWLEVFYQQPVMTPDNTLMDVISNALDYKGGNQAISATAEQLSQLANALRQIGQTGQASLA 77 89************************************************************************* PP TIGR03536 77 aklkeskrplvavlleedaapasvpeaylklqllshrlvkphgvnleGifgllknvawtneGaidleelaerqle 151 k+++skrp+v+++le+d+ ++s+pe+ylkl+l+shr++kphg++l+Gifgll+n+awt+eGaidl+el++rql+ lcl|FitnessBrowser__Marino:GFF1183 78 DKAAASKRPVVVTVLETDDTASSTPEVYLKLHLISHRMAKPHGLKLDGIFGLLPNLAWTSEGAIDLNELSDRQLQ 152 *************************************************************************** PP TIGR03536 152 arlnGevlevdsvdkfpkmtdyvvpkGvriadtarvrlGayvGeGttvmheGfvnfnaGteGasmveGrisaGvl 226 arl+G++lev+svdkfp+mtdyvvpkGvriadtarvrlGayvGeGttvmheGf+nfnaGteG+sm+eGrisaGv+ lcl|FitnessBrowser__Marino:GFF1183 153 ARLEGRTLEVKSVDKFPQMTDYVVPKGVRIADTARVRLGAYVGEGTTVMHEGFINFNAGTEGTSMIEGRISAGVM 227 *************************************************************************** PP TIGR03536 227 vGkGsdlGGGastmGtlsGGGnivisvGeecllGanaGiGiplGdrctveaGlyitaGtkvallddkgelvevvk 301 vGkGsdlGGG+stmGtlsGGGni+i vGe+cl+GanaGiGiplGdrc+veaGlyitaGtkvalldd++elvev+k lcl|FitnessBrowser__Marino:GFF1183 228 VGKGSDLGGGCSTMGTLSGGGNIIIAVGENCLIGANAGIGIPLGDRCKVEAGLYITAGTKVALLDDNNELVEVIK 302 *************************************************************************** PP TIGR03536 302 ardlaGksdllfrrnslnGavecltnksaielneelhann 341 ardla ++dllfrrns++Gavec+tnksaielneelhann lcl|FitnessBrowser__Marino:GFF1183 303 ARDLANQTDLLFRRNSQTGAVECKTNKSAIELNEELHANN 342 **************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (341 nodes) Target sequences: 1 (342 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.30 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory