Align 2-aminoadipate transaminase (EC 2.6.1.39) (characterized)
to candidate GFF1728 HP15_1687 transcriptional regulator, GntR family with aminotransferase domain protein
Query= BRENDA::Q72LL6 (397 letters) >FitnessBrowser__Marino:GFF1728 Length = 480 Score = 137 bits (344), Expect = 9e-37 Identities = 110/342 (32%), Positives = 164/342 (47%), Gaps = 16/342 (4%) Query: 38 AGGLPAPELFPKEEAAEAAARILREKGEVALQYSPTEGYAPLRAFVAEWIGVR-----PE 92 AG LP P + A A R R++G Y G LR + + R P+ Sbjct: 127 AGELP-PGIVSLNRAIGRALR--RQRGADFQYYDKPAGDLKLREQLGLLLAKRGWPVTPD 183 Query: 93 EVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFLTVPAGE-EGPDL 151 E+ IT+G Q AL L G V +E+P + G +Q G + + +P G D+ Sbjct: 184 ELCITSGCQHALFLALMACCQRGDVVAVESPGFYGVLQLLEQLGLQVMEIPTSTASGMDM 243 Query: 152 DALEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYFG 211 DALEE L R + + P+F P G L R+RL+ + + L V+EDD Y E F Sbjct: 244 DALEEALGRWNIQACVVSPAFATPGGALMSEAPRRRLMALAEKYDLAVIEDDIYAESGF- 302 Query: 212 EARLPSLFELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTP 271 +R+P + E VI+ SFSKVLS LR+ + ++ Q+++ K L + Sbjct: 303 -SRVPDTLKALDENNR--VIHCSSFSKVLSRDLRLGW-ISGARWHQRILHLKMVTQLASS 358 Query: 272 MLNQMLVHELLKEG-FSERLERVRRVYREKAQAMLHALDREVPKEVRYTRPKGGMFVWME 330 Q V ++EG S L R R+V E+ +L +L P VR T P+GG+ VW+E Sbjct: 359 RYLQQGVAAYMEEGELSAHLRRQRKVLSEQRDRLLASL-LAWPVSVRVTAPQGGLAVWLE 417 Query: 331 LPKGLSAEGLFRRALEENVAFVPGGPFFANGGGENTLRLSYA 372 LP + ++ +AL+ V PG F A+G N LR+S++ Sbjct: 418 LPATVDTLAVYPKALDAGVVITPGPLFSASGKYGNCLRISFS 459 Lambda K H 0.320 0.139 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 496 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 480 Length adjustment: 32 Effective length of query: 365 Effective length of database: 448 Effective search space: 163520 Effective search space used: 163520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory