Align 2-aminoadipate transaminase (2.6.1.39) (characterized)
to candidate GFF349 HP15_347 glutamate-1-semialdehyde 2,1-aminomutase
Query= reanno::Putida:PP_4108 (416 letters) >FitnessBrowser__Marino:GFF349 Length = 426 Score = 136 bits (343), Expect = 1e-36 Identities = 99/297 (33%), Positives = 152/297 (51%), Gaps = 15/297 (5%) Query: 15 PITLSHGRNAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQATRLTHYAFNAAPH 74 PI H + A ++D D +RYID++G G + LGH + + +A+ AQ Y AP Sbjct: 33 PIFFKHAQGAYLYDEDDQRYIDYIGSWGPMILGHGDQRIKDALHAQVDLGVGYG---APT 89 Query: 75 GPYLALMEQLSQFVPVSYPLAGMLTNSGAEAAENALKVARGATGKRAIIAFDGGFHGRTL 134 + +++ + +P S L M+ NSG EA + +++ARG TG+ I+ F+G +HG Sbjct: 90 ALETEMAKKVCELMP-SIELVRMV-NSGTEATMSTVRLARGYTGRDKIVKFEGCYHGHVD 147 Query: 135 ATLNLNGKVAPYKQRVGELPGPVYHLPYPSADTGVTCEQALKAMDRLFSVELAVEDVAAF 194 + L G A V PG +P A+ +T R E+ + +AA Sbjct: 148 SLLVKAGSGA-LTLGVPNSPG----IPASLAEHTITLTYNDIDSVRECFREMG-DQIAAI 201 Query: 195 IFEPVQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGRTGQRFAFPRLGIEPDL 254 I EPV G + P F + LR CDE G ++I DE+ +GF R A G+ PDL Sbjct: 202 IVEPVAGNMNCIPPVPGFLEGLREVCDEHGTVLIFDEVMTGF-RVSLGGAQGLYGVTPDL 260 Query: 255 LLLAKSIAGGMPLGAVVGRKELMAAL-PKGGL--GGTYSGNPISCAAALASLAQMTD 308 L K I GG+P+GA G++E+M + P G + GT SGNP++ A L +L +++ Sbjct: 261 TALGKVIGGGLPVGAFGGKREIMEHISPLGPVYQAGTLSGNPLAMCAGLTTLNAISE 317 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 432 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 426 Length adjustment: 32 Effective length of query: 384 Effective length of database: 394 Effective search space: 151296 Effective search space used: 151296 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory