Align amino-acid N-acetyltransferase (EC 2.3.1.1) (characterized)
to candidate GFF3375 HP15_3317 acetylglutamate kinase
Query= BRENDA::Q87EL2 (421 letters) >FitnessBrowser__Marino:GFF3375 Length = 298 Score = 121 bits (303), Expect = 3e-32 Identities = 86/282 (30%), Positives = 139/282 (49%), Gaps = 24/282 (8%) Query: 10 YLKRFSQLDAKRFAVVKVGGAVLRDD--VDALTSSLSFLQEVGLTPIVLHGAGPQLDEEL 67 Y++RF+ + V+K GG + ++ + + ++ VG+ PIV+HG GPQ+ E L Sbjct: 21 YIQRFTG----KTVVIKYGGNAMENEDLKSSFARDVVLMKLVGINPIVVHGGGPQIGELL 76 Query: 68 TAVGIQKKTVNGFRVTLPETMAIVRKVFHA-TNLQLIEALQRNGARATSITG---GVFEA 123 + IQ + VNG RVT ETM +V V N +++ + +G A +TG + A Sbjct: 77 ERLNIQSRFVNGMRVTDSETMDVVEMVLGGQVNKEIVSLINSHGGMAVGLTGKDANLIRA 136 Query: 124 HYLDQET------------YGLVGGISAVNIAPIEASLRAASIPVIASLGETPSGQILNI 171 L+ G VG +++VN+ IE R+ IPVIA +G P G NI Sbjct: 137 RKLEVVDRSPELERPEIIDIGHVGEVASVNVDVIEMLTRSNLIPVIAPIGVGPDGASYNI 196 Query: 172 NADVAANELVHVLQPYKIIFLTGTGGLLDADGKIINSINLSTEYEQLIQQPWVYGGMKLK 231 NAD+ A ++ ++ K++ LT GL + K++ + + + LI+ ++GGM K Sbjct: 197 NADLVAGKVAEAMKAEKLMLLTNVSGLKSKEDKVLTGLT-AKQVNDLIEDGTIHGGMLPK 255 Query: 232 IEQIKHLLDRLPLESSVSITRPADLA-KELFTHKGSGTLIRR 272 I ++ S + R A E+FT +G GTLI R Sbjct: 256 IRCALSAVENGVRTSHIIDGRVAHACLLEIFTDEGVGTLISR 297 Lambda K H 0.320 0.136 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 298 Length adjustment: 29 Effective length of query: 392 Effective length of database: 269 Effective search space: 105448 Effective search space used: 105448 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory