Align Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 (uncharacterized)
to candidate GFF2981 HP15_2925 adenosylmethionine-8-amino-7-oxononanoate transaminase
Query= curated2:P63566 (403 letters) >FitnessBrowser__Marino:GFF2981 Length = 450 Score = 164 bits (414), Expect = 6e-45 Identities = 129/418 (30%), Positives = 203/418 (48%), Gaps = 52/418 (12%) Query: 22 ERGEGIWLITEDGERYIDFAAGIAVNSLGHSHPHLVETLKTQAEKLWH--LSNVYEIPAQ 79 +RGEG+WL +G R+ID + VN GH++P + ++ Q +L H L+ P Sbjct: 34 KRGEGVWLEDFEGNRFIDAVSSWWVNLFGHANPRINAAIQKQIGELEHVILAGFTHEPVV 93 Query: 80 EKLGRRLVEST--FADKVFFTNSGAEALECAIKTARRYQYVSGHPERFRIITFEGAFHGR 137 L RL+E T +KVF+ ++G+ A+E A+K + Y P + + ++HG Sbjct: 94 N-LSERLIEVTPPGLNKVFYADNGSSAIEAALKMSFHYWKNHDKPGKKNFVNLSNSYHGE 152 Query: 138 TLATIAAGGQAKYLEGF---------GPKVEGFDQVP--FGDEAALR---------AAIT 177 TL +A G + Y + + P + F++ P ++ ALR A Sbjct: 153 TLGALALGDVSLYKDTYQPLLMEVLTAPSPDAFNKEPGETDEDYALRQFEAMEKLLAEKH 212 Query: 178 PETAGILLEP-IQGEGGLRAFPEEFLRLVRQICDENGLLLLLDEVQTGVGRTGKLFAHEW 236 E +++EP IQ GG+R + +R+ CD G+ L+ DE+ G GRTG LFA E Sbjct: 213 EEICAVVVEPLIQCAGGMRMHHPIYHTKLREACDRYGVHLIADEIAVGFGRTGTLFACEQ 272 Query: 237 AGIRPDIMAIAKGIGGGF-PIGACLATAEAAKG-------MTAGMHGTTYGGNPLGMAVG 288 +GI PD M ++KG+ G+ P+ L T + + A +H +Y GNP+G AV Sbjct: 273 SGITPDFMCLSKGLTAGYLPLSVVLTTDDVYNAFYDDYETLKAFLHSHSYTGNPIGCAVA 332 Query: 289 NAVLDVVLADGFMENVQATALVMKQGLASLVDRYPNVVSEIRGRGLLMGLKCVVPNTSLI 348 A LD+ D +E+ +A + M + +A L D +PN V +IR G+ + ++ V S Sbjct: 333 LATLDIFRDDNVIESNRALSTCMAESVAHLAD-HPN-VGDIRQHGMTLAVEMVKDKASKT 390 Query: 349 ----QALRD----EHILSVGA----GDNVVRLLPPLITTPEEARE----ALKHIETAV 390 Q R +H L+ A NVV +PP + T E+ R A + IE AV Sbjct: 391 PFPWQERRGIRVYQHALTRQALLRPLGNVVYFMPPYVITEEQIRHLAQVATEGIEIAV 448 Lambda K H 0.320 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 440 Number of extensions: 30 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 450 Length adjustment: 32 Effective length of query: 371 Effective length of database: 418 Effective search space: 155078 Effective search space used: 155078 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory