Align glutamate 5-kinase (EC 2.7.2.11) (characterized)
to candidate GFF520 HP15_508 gamma-glutamyl kinase
Query= BRENDA::P0A7B5 (367 letters) >FitnessBrowser__Marino:GFF520 Length = 374 Score = 286 bits (733), Expect = 5e-82 Identities = 157/366 (42%), Positives = 221/366 (60%), Gaps = 1/366 (0%) Query: 1 MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHL 60 + ++ LV+K+G+++LT R L+ A + V Q A+L G +V+V+SG++A G L Sbjct: 7 LRQARRLVIKIGSALLTNDGRGLDVAALGLWVDQIAELIEDGVEVVVVSSGSVAEGMSRL 66 Query: 61 GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDT 120 G+ P + Q AAVGQ L+Q WE F + IH Q+LLT D+ DR+R+LN R T Sbjct: 67 GWTVRPEQLHELQAAAAVGQMGLVQTWEAQFKRHDIHTAQILLTHDDLSDRKRYLNGRGT 126 Query: 121 LRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQKGLYTADPR 180 LRALL+ +VP++NEND V T EI+ GDND L AL A L AD L++LTDQ GL+ DPR Sbjct: 127 LRALLNLGVVPIVNENDTVVTDEIRFGDNDTLGALVANLIEADGLIILTDQLGLFDKDPR 186 Query: 181 SNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIAAGSKPG 240 + A L+ + D L A+AG LG GGM TKL+AA +A R+G T+I G G Sbjct: 187 KHSDACLVTERRAGDRELDAMAGGGAGVLGRGGMQTKLRAARLAARSGAFTVIVGGRIEG 246 Query: 241 VIGDVMEGISVGTLFHAQATPLENRKRWIFG-APPAGEITVDEGATAAILERGSSLLPKG 299 VIG + +G +GTL + + RK+W+ G +T+D+GA + G SLLP G Sbjct: 247 VIGRLRQGDVIGTLLLPEQGRIAARKQWLASHLQTRGRLTLDDGAVKVLCLGGRSLLPVG 306 Query: 300 IKSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAGHHSQEIDAILGYEYGPVAV 359 +K V+G F RGE++ + GR+IA G+ Y++D R IAG S I ILGY G + Sbjct: 307 VKGVSGQFRRGEMVSCFDQSGREIARGLVNYDADEARAIAGRSSDRITEILGYMSGEEMI 366 Query: 360 HRDDMI 365 HRD+++ Sbjct: 367 HRDNLV 372 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 374 Length adjustment: 30 Effective length of query: 337 Effective length of database: 344 Effective search space: 115928 Effective search space used: 115928 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate GFF520 HP15_508 (gamma-glutamyl kinase)
to HMM TIGR01027 (proB: glutamate 5-kinase (EC 2.7.2.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01027.hmm # target sequence database: /tmp/gapView.6143.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01027 [M=363] Accession: TIGR01027 Description: proB: glutamate 5-kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-129 418.3 0.2 1.7e-129 418.1 0.2 1.0 1 lcl|FitnessBrowser__Marino:GFF520 HP15_508 gamma-glutamyl kinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Marino:GFF520 HP15_508 gamma-glutamyl kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 418.1 0.2 1.7e-129 1.7e-129 1 363 [] 11 373 .. 11 373 .. 0.99 Alignments for each domain: == domain 1 score: 418.1 bits; conditional E-value: 1.7e-129 TIGR01027 1 kriVvKlGsssLteesgklkrsklaelveqvaklkkaGhevvivsSGavaaGleaLglperpkklaekQalaaVGQ 76 +r+V+K+Gs++Lt++ + l+ + l v q+a+l ++G evv+vsSG+va G+++Lg + rp++l+e Qa+aaVGQ lcl|FitnessBrowser__Marino:GFF520 11 RRLVIKIGSALLTNDGRGLDVAALGLWVDQIAELIEDGVEVVVVSSGSVAEGMSRLGWTVRPEQLHELQAAAAVGQ 86 589************************************************************************* PP TIGR01027 77 grLmklyeklfsqyglkvaQiLLtradlskrerylNarntleellelgvvpivNENDtvaveeikfGDNDtLsalv 152 L++++e++f+++++++aQiLLt++dls+r+rylN r tl++ll+lgvvpivNENDtv ++ei+fGDNDtL alv lcl|FitnessBrowser__Marino:GFF520 87 MGLVQTWEAQFKRHDIHTAQILLTHDDLSDRKRYLNGRGTLRALLNLGVVPIVNENDTVVTDEIRFGDNDTLGALV 162 **************************************************************************** PP TIGR01027 153 aalveAdlLvlltdvdgLydadprtnpdAklieeveeieeelkavagssgssvGTGGmrtKleaaelAsragvevi 228 a+l+eAd L++ltd+ gL+d+dpr+++dA l+ e ++ ++el+a+ag+++ +G GGm+tKl aa+lA+r+g ++ lcl|FitnessBrowser__Marino:GFF520 163 ANLIEADGLIILTDQLGLFDKDPRKHSDACLVTERRAGDRELDAMAGGGAGVLGRGGMQTKLRAARLAARSGAFTV 238 ************************************************9999************************ PP TIGR01027 229 iasgekpekiadlledaavgtlfeakkkklknrkqwilaaseakGkiivdegaeeallekgksLlpagvvevegnF 304 i+ g+ + i +l ++ +gtl+ +++ ++ +rkqw++ +++++G++++d+ga++ l g+sLlp+gv +v+g+F lcl|FitnessBrowser__Marino:GFF520 239 IVGGRIEGVIGRLRQGDVIGTLLLPEQGRIAARKQWLASHLQTRGRLTLDDGAVKVLCLGGRSLLPVGVKGVSGQF 314 **************************************************************************** PP TIGR01027 305 srgevveilaeegqeigkglvnysseelekikglkseeiedvLgyekkeevvhrdnlvl 363 +rge+v++ +++g+ei++glvny+++e + i+g++s+ i+++Lgy + ee +hrdnlv+ lcl|FitnessBrowser__Marino:GFF520 315 RRGEMVSCFDQSGREIARGLVNYDADEARAIAGRSSDRITEILGYMSGEEMIHRDNLVI 373 ********************************************************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (363 nodes) Target sequences: 1 (374 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.98 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory