Align Phosphoserine phosphatase ThrH; PSP; PSPase; EC 3.1.3.3 (characterized)
to candidate GFF1895 HP15_1852 homoserine kinase
Query= SwissProt::Q9I2Y2 (205 letters) >FitnessBrowser__Marino:GFF1895 Length = 218 Score = 314 bits (805), Expect = 7e-91 Identities = 151/199 (75%), Positives = 174/199 (87%) Query: 1 MEIACLDLEGVLVPEIWIAFAEKTGIDALKATTRDIPDYDVLMKQRLRILDEHGLKLGDI 60 +E+ACLDLEGVL+PEIWIAFAEKTGI+ LKATTRDIPDYDVLMKQRL++LD+HG L I Sbjct: 15 VELACLDLEGVLIPEIWIAFAEKTGIEELKATTRDIPDYDVLMKQRLKLLDQHGYGLPQI 74 Query: 61 QEVIATLKPLEGAVEFVDWLRERFQVVILSDTFYEFSQPLMRQLGFPTLLCHKLEIDDSD 120 QEVI L PL GA EF+DWLRERFQVVILSDTFYEF+ PLM++LG+P LLCHKLE+ D Sbjct: 75 QEVIGELDPLPGAREFLDWLRERFQVVILSDTFYEFAMPLMKKLGYPALLCHKLEVADDG 134 Query: 121 RVVGYQLRQKDPKRQSVIAFKSLYYRVIAAGDSYNDTTMLSEAHAGILFHAPENVIREFP 180 ++ Y LRQ+DPKRQSV AF+ L YRVIAAGDSYNDTTML +A AGILFHAP+NVI EFP Sbjct: 135 QITNYLLRQRDPKRQSVRAFQLLNYRVIAAGDSYNDTTMLGQAEAGILFHAPQNVIDEFP 194 Query: 181 QFPAVHTYEDLKREFLKAS 199 QFPAVH ++DL++EFLKAS Sbjct: 195 QFPAVHNFDDLRQEFLKAS 213 Lambda K H 0.323 0.140 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 205 Length of database: 218 Length adjustment: 21 Effective length of query: 184 Effective length of database: 197 Effective search space: 36248 Effective search space used: 36248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 45 (21.9 bits)
Align candidate GFF1895 HP15_1852 (homoserine kinase)
to HMM TIGR02137 (thrH: phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein (EC 3.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR02137.hmm # target sequence database: /tmp/gapView.11144.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02137 [M=203] Accession: TIGR02137 Description: HSK-PSP: phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-106 339.8 0.0 3e-106 339.4 0.0 1.0 1 lcl|FitnessBrowser__Marino:GFF1895 HP15_1852 homoserine kinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Marino:GFF1895 HP15_1852 homoserine kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 339.4 0.0 3e-106 3e-106 2 200 .. 16 214 .. 15 216 .. 0.99 Alignments for each domain: == domain 1 score: 339.4 bits; conditional E-value: 3e-106 TIGR02137 2 evvtldlegvlvpeiwiavaektgiddlklttrdipdydvlmkqrlkileeenlklsdiqeviatlkllegavef 76 e+++ldlegvl+peiwia+aektgi++lk+ttrdipdydvlmkqrlk+l++++ l +iqevi +l++l ga+ef lcl|FitnessBrowser__Marino:GFF1895 16 ELACLDLEGVLIPEIWIAFAEKTGIEELKATTRDIPDYDVLMKQRLKLLDQHGYGLPQIQEVIGELDPLPGAREF 90 789************************************************************************ PP TIGR02137 77 vdtlreeaqvvilsdtfqefaqplmkqlgfptllchklvvedsdrvkgyqlrqkdqkrkvvkalkelyykviaag 151 +d+lre++qvvilsdtf+efa plmk+lg+p+llchkl+v d ++ y lrq+d+kr++v+a++ l+y+viaag lcl|FitnessBrowser__Marino:GFF1895 91 LDWLRERFQVVILSDTFYEFAMPLMKKLGYPALLCHKLEVADDGQITNYLLRQRDPKRQSVRAFQLLNYRVIAAG 165 ******************************************9******************************** PP TIGR02137 152 dsyndttmlkeadkgilfhapesvvaefpqleavktyeelkdkflkasd 200 dsyndttml +a++gilfhap++v+ efpq++av+ +++l+++flkas+ lcl|FitnessBrowser__Marino:GFF1895 166 DSYNDTTMLGQAEAGILFHAPQNVIDEFPQFPAVHNFDDLRQEFLKASE 214 **********************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (203 nodes) Target sequences: 1 (218 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.74 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory