Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate GFF3348 HP15_3290 anthranilate phosphoribosyltransferase
Query= SwissProt::Q8PD71 (345 letters) >FitnessBrowser__Marino:GFF3348 Length = 342 Score = 300 bits (769), Expect = 3e-86 Identities = 162/338 (47%), Positives = 218/338 (64%), Gaps = 5/338 (1%) Query: 6 QQALQRTIEHREIFHDEMVDLMRQIMRGEVSDAMVSAILTGLRVKKETIGEIAGAATVMR 65 ++AL R + ++ +EM D+MR +M GE +DA + A L GLR+K ETI EI GA VMR Sbjct: 4 KEALNRIASNLDLSREEMKDVMRIVMNGEATDAQIGAFLMGLRLKSETIDEITGATEVMR 63 Query: 66 EFSRRVEVTDRRHMVDIVGTGGDGSHTFNISTCAMFVAAAGGAKVAKHGNRSVSSKSGSA 125 E + +V V +VDIVGTGGDG++ FN+S+ A FV AA G VAKHGNR+VSSKSGSA Sbjct: 64 ELATKVSVK-AEPLVDIVGTGGDGANLFNVSSAASFVVAAAGGFVAKHGNRAVSSKSGSA 122 Query: 126 DALEALGAVIELQPEQVAASLAQTGIGFMYAPVHHPAMKVVAPVRREMGVRTIFNILGPL 185 D LE LG + ++PE+VA + + G+GFM+AP HH AMK R+E+G RTIFNILGP+ Sbjct: 123 DLLEKLGINLSMKPEEVARCVEEIGVGFMFAPAHHGAMKHAIGPRKELGCRTIFNILGPM 182 Query: 186 TNPAGSPNILMGVFHPDLVGIQARVLQELGAERALVVWGRDGMDELSLGAGTLVGELRDG 245 TNPAG L+GVF+ +L VL LGAE +VV +DG+DE+SL + T V EL+DG Sbjct: 183 TNPAGVKRQLVGVFNRELCRPMTEVLHRLGAEHIMVVCSKDGLDEISLASATHVAELKDG 242 Query: 246 QVHEYEVHPEDFGIAMSASRNLKVADAAESRAMLLQVL----DNVPGPALDIVALNAGAA 301 +V EY++ PED GI A L V A +S ++ D + A D++ALNAGAA Sbjct: 243 KVTEYDITPEDLGIKSQALVGLTVDTADDSLKLIKAAFGRGHDEMAEKARDLIALNAGAA 302 Query: 302 LYVAGVADSIADGIVRARQVLADGSARACLDAYVAFTQ 339 +YVAG+A + +G+ A + G A + F+Q Sbjct: 303 IYVAGLAKTPKEGVDMALDAMGSGLAAGKMSELADFSQ 340 Lambda K H 0.320 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 328 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 345 Length of database: 342 Length adjustment: 29 Effective length of query: 316 Effective length of database: 313 Effective search space: 98908 Effective search space used: 98908 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate GFF3348 HP15_3290 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.1320.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.8e-125 402.2 3.4 1.1e-124 402.0 3.4 1.0 1 lcl|FitnessBrowser__Marino:GFF3348 HP15_3290 anthranilate phosphori Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Marino:GFF3348 HP15_3290 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 402.0 3.4 1.1e-124 1.1e-124 1 329 [. 7 337 .. 7 338 .. 0.97 Alignments for each domain: == domain 1 score: 402.0 bits; conditional E-value: 1.1e-124 TIGR01245 1 leklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkvekeeseelvDiv 75 l+++++n dLs+ee++++m+ +m+gea+daqi+A+l+ lr k+et++ei+g+ +++re a+kv+++ +e lvDiv lcl|FitnessBrowser__Marino:GFF3348 7 LNRIASNLDLSREEMKDVMRIVMNGEATDAQIGAFLMGLRLKSETIDEITGATEVMRELATKVSVK-AEPLVDIV 80 5789999**********************************************************5.******** PP TIGR01245 76 GTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsleevgigFlfAPk 150 GTGGDg++ +N+S a+++v+aaaG vaKhGnr+vssksGsaD+Le+lg+nl ++pe+var++ee g+gF+fAP+ lcl|FitnessBrowser__Marino:GFF3348 81 GTGGDGANLFNVSSAASFVVAAAGGFVAKHGNRAVSSKSGSADLLEKLGINLSMKPEEVARCVEEIGVGFMFAPA 155 *************************************************************************** PP TIGR01245 151 yhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlgvkralvvhgedglDEisl 225 +h a+k++++ RkeLg rt+fN+LGP++nPa +k+q++Gv++++l++ + evl++lg+++++vv+++dglDEisl lcl|FitnessBrowser__Marino:GFF3348 156 HHGAMKHAIGPRKELGCRTIFNILGPMTNPAGVKRQLVGVFNRELCRPMTEVLHRLGAEHIMVVCSKDGLDEISL 230 *************************************************************************** PP TIGR01245 226 tgetkvaelkdgeieeytlspedfglkraeleelkggsaeenaellkevl...egkekkakrdivvlNaaaalyv 297 t+vaelkdg+++ey+++ped+g+k + l l +++a+++++l+k+++ + ++ +++rd+++lNa+aa+yv lcl|FitnessBrowser__Marino:GFF3348 231 ASATHVAELKDGKVTEYDITPEDLGIKSQALVGLTVDTADDSLKLIKAAFgrgHDEMAEKARDLIALNAGAAIYV 305 ***********************************************999422234478899************* PP TIGR01245 298 agkakdlkegvelakeaiksgkalekleelva 329 ag ak+ kegv++a++a+ sg a+ k++el++ lcl|FitnessBrowser__Marino:GFF3348 306 AGLAKTPKEGVDMALDAMGSGLAAGKMSELAD 337 ***********************999998875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (342 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 11.65 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory