Align N-acetyl-gamma-glutamyl-phosphate reductase; Short=AGPR; EC 1.2.1.38 (characterized, see rationale)
to candidate 8500980 DvMF_1717 N-acetyl-gamma-glutamyl-phosphate reductase (RefSeq)
Query= uniprot:E4PLW0 (388 letters) >FitnessBrowser__Miya:8500980 Length = 350 Score = 315 bits (808), Expect = 1e-90 Identities = 165/349 (47%), Positives = 224/349 (64%), Gaps = 5/349 (1%) Query: 44 VIKVGIVGGTGYTGVELLRILAVHPEVSVSCITSRSEAGMPVAEMYPNLRG----HYDLA 99 +I+ G+VG TGYTG+EL R+LA HP + + TSR+EAG P++++YP LRG + + Sbjct: 3 IIRAGLVGVTGYTGMELTRLLAGHPNMRLVRATSRTEAGRPLSDIYPFLRGLPGGNAVMT 62 Query: 100 FSEPDVNVLGACDLVFFATPHGVAMRMVPELMSAGVRVVDLSADFRLKDLDVWANWYGMA 159 +PD ++ CD+ F A PHG AM M L G+RVVDLSADFRL+D DV+ WY + Sbjct: 63 APDPD-DLADNCDVAFLAVPHGAAMEMGATLRQRGLRVVDLSADFRLRDPDVYEAWYKVP 121 Query: 160 HESPEWAEKAVYGLPEVVRDEIRNAQLVANPGCYPTAVQLGFLPLLEQGLVDPKRLIADA 219 H +AVYGLPE+ D ++ A LVANPGCYPTA LG L+ GLV+ ++ DA Sbjct: 122 HTRRAELPQAVYGLPELYGDAVKKAGLVANPGCYPTATILGLYAALKHGLVETDGIVVDA 181 Query: 220 KSGASGAGRQGKIGMLHGEIGESFKAYGASGHRHLPEIRQGLCGAAGGDVGVTFVPHLIP 279 KSGA+GAGR+ +G L E+ ++F+AY HRH PEI Q L AG + V+F PHL+P Sbjct: 182 KSGATGAGRKAAVGTLFCEVSDTFRAYNIGKHRHTPEIEQELSAIAGTSMVVSFNPHLLP 241 Query: 280 MIRGIEATLYAELKNPADFDRLQALFEQRFDDEPFVDVMPFGSHPETRSVRGANQCRMAL 339 + RGI AT+YA+L P +QA FEQ + +V V+P G PETR VRG C + + Sbjct: 242 INRGILATIYAKLAKPVSPQDVQAAFEQTWQGSRWVRVLPAGQLPETRHVRGTMFCDVGV 301 Query: 340 HRQEQSNIVIVSSVIDNLVKGAAGQAVQNMNIMFGLKETMGLEAPALLP 388 +++N +++ S IDNL +GA+GQAV N N+MFGL GL L+P Sbjct: 302 VTDQRTNRLVILSAIDNLCRGASGQAVANANLMFGLPVETGLMLAPLMP 350 Lambda K H 0.321 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 388 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 350 Length adjustment: 30 Effective length of query: 358 Effective length of database: 320 Effective search space: 114560 Effective search space used: 114560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate 8500980 DvMF_1717 (N-acetyl-gamma-glutamyl-phosphate reductase (RefSeq))
to HMM TIGR01850 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01850.hmm # target sequence database: /tmp/gapView.8424.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01850 [M=345] Accession: TIGR01850 Description: argC: N-acetyl-gamma-glutamyl-phosphate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-128 415.0 0.0 1.5e-128 414.8 0.0 1.0 1 lcl|FitnessBrowser__Miya:8500980 DvMF_1717 N-acetyl-gamma-glutamy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Miya:8500980 DvMF_1717 N-acetyl-gamma-glutamyl-phosphate reductase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 414.8 0.0 1.5e-128 1.5e-128 1 345 [] 4 350 .] 4 350 .] 0.98 Alignments for each domain: == domain 1 score: 414.8 bits; conditional E-value: 1.5e-128 TIGR01850 1 ikvaivGasGYtGaeLlrllakHpevevtklvssreagkklsevhphlkglvd..lkleeleeeeileeadvvflAl 75 i++++vG +GYtG+eL rlla Hp++++++++s++eag++ls+++p l+gl + +++ + +++++++dv flA+ lcl|FitnessBrowser__Miya:8500980 4 IRAGLVGVTGYTGMELTRLLAGHPNMRLVRATSRTEAGRPLSDIYPFLRGLPGgnAVMTAPDPDDLADNCDVAFLAV 80 5789*************************9999999**************988645566666699************ PP TIGR01850 76 phgvsaelvpellekgvkvidlSadfRlkdaevYekwYgkkhekeelleeavYGlpElnreeikkaklianPGCyaT 152 phg+++e+ ++l ++g++v+dlSadfRl+d++vYe+wY+ +h++++ l +avYGlpEl+ +++kka l+anPGCy+T lcl|FitnessBrowser__Miya:8500980 81 PHGAAMEMGATLRQRGLRVVDLSADFRLRDPDVYEAWYKVPHTRRAELPQAVYGLPELYGDAVKKAGLVANPGCYPT 157 ***************************************************************************** PP TIGR01850 153 aalLalaPllkekliepksiivdaksGvSgAGrkasekslfaevnenlkpYkvtkHrHtpEieqelsklaekkvkvs 229 a++L+l+ +lk++l+e++ i+vdaksG +gAGrka +lf+ev++ +++Y++ kHrHtpEieqels++a+++++vs lcl|FitnessBrowser__Miya:8500980 158 ATILGLYAALKHGLVETDGIVVDAKSGATGAGRKAAVGTLFCEVSDTFRAYNIGKHRHTPEIEQELSAIAGTSMVVS 234 *****************99********************************************************** PP TIGR01850 230 ftphlvpmtrGilatiyaklkkelteeelrklyeevYedepfvrvlkegelPstkavlgsnfvdigvavdeetkrvv 306 f phl+p+ rGilatiyakl+k+++ +++++++e++++++++vrvl++g+lP+t++v+g+ f+d+gv +d++t+r+v lcl|FitnessBrowser__Miya:8500980 235 FNPHLLPINRGILATIYAKLAKPVSPQDVQAAFEQTWQGSRWVRVLPAGQLPETRHVRGTMFCDVGVVTDQRTNRLV 311 ***************************************************************************** PP TIGR01850 307 vvsaiDNLvKGaagqAvqnlNlmlgfdetegLeklpllp 345 ++saiDNL +Ga+gqAv n Nlm+g++ ++gL pl+p lcl|FitnessBrowser__Miya:8500980 312 ILSAIDNLCRGASGQAVANANLMFGLPVETGLMLAPLMP 350 **********************************99998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (345 nodes) Target sequences: 1 (350 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.74 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory