Align Succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate 8500245 DvMF_1002 adenosylmethionine-8-amino-7-oxononanoate aminotransferase (RefSeq)
Query= reanno::pseudo1_N1B4:Pf1N1B4_3440 (406 letters) >FitnessBrowser__Miya:8500245 Length = 491 Score = 164 bits (416), Expect = 4e-45 Identities = 130/404 (32%), Positives = 198/404 (49%), Gaps = 48/404 (11%) Query: 33 GSRVWDQSGRELIDFAGGIAVNVLGHAHPALVAALTEQANKLWHVSNV-FTNEPALRLAH 91 G+R+ D G +D + NV GH HP L AA+ Q +K+ H + + +EP++ LA Sbjct: 58 GNRLTDTDGVSYLDGVSSLWTNVHGHRHPRLDAAIRAQLDKVAHTTLLGLGSEPSIELAA 117 Query: 92 KL--VDATFAERVFFCNSGAEANEAAFKLA-----RRVAHDRFGTEKYEIVAALNSFHGR 144 +L + RVF+ +SG+ + E A K+A + AH + ++ N++HG Sbjct: 118 RLAAIAPQGLTRVFYSDSGSTSVEVALKIAFQFHRQAPAHLGGDARRTRFLSLRNAYHGD 177 Query: 145 TLFTVNVGGQSKYSDGFGPKI--TGITHVPY------------------NDLAALKAAVS 184 T+ V +GG + + + P + T PY + L A Sbjct: 178 TVGAVALGGMALFHSIYAPLLFDTVKAESPYCYRCPFGRQAGSCERECITHMETLFARHG 237 Query: 185 DKTCAVVLEP-IQGEGGVLPAELSYLQGARELCDAHNALLVFDEVQTGMGRSGKLFAYQH 243 + CA V+EP +QG G+L +L+ RELCD H LV DEV G G++G LFA + Sbjct: 238 HELCAAVVEPLVQGAAGMLLQPPGWLRRVRELCDEHGVFLVADEVAVGFGKTGTLFACEQ 297 Query: 244 YGVTPDILTSAKSLGGGF-PIAAMLTTED-----LAKHLVVGT--HGTTYGGNPLACAVA 295 GVTPD L AK + GG+ P+AA LTTE LA+H + T HG TY GNPLACA A Sbjct: 298 EGVTPDFLCLAKGISGGYLPLAATLTTERVHDGFLARHEELRTFFHGHTYTGNPLACAAA 357 Query: 296 EAVIDVINTPEVLNGVNAKHDKFKTRLEQIGEKYGLFTEVRGLGLLLGC-VLSDAWKGKA 354 A +DV V+ + K + RL+ + + + ++R G++ G ++ + +A Sbjct: 358 IASLDVFEEERVMERLQPKIARLAARLDTLRDLPHV-GDIRQRGVMTGIEMVRNRATKEA 416 Query: 355 KD--------IFNAAEREGLMILQAGPDVIRFAPSLVVEDADID 390 D + A R G++I G DV+ P L + D +ID Sbjct: 417 YDLALRVGHRVTLEARRRGVIIRPLG-DVMVLMPPLSITDDEID 459 Lambda K H 0.320 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 459 Number of extensions: 27 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 491 Length adjustment: 33 Effective length of query: 373 Effective length of database: 458 Effective search space: 170834 Effective search space used: 170834 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory