Align 3-dehydroquinate synthase; DHQ synthase; 3-dehydroquinate synthase II; EC 1.4.1.24 (characterized)
to candidate 8501013 DvMF_1750 3-dehydroquinate synthase (RefSeq)
Query= SwissProt::Q58646 (361 letters) >lcl|FitnessBrowser__Miya:8501013 DvMF_1750 3-dehydroquinate synthase (RefSeq) Length = 323 Score = 233 bits (595), Expect = 4e-66 Identities = 138/310 (44%), Positives = 194/310 (62%), Gaps = 14/310 (4%) Query: 54 LDADIVLVNKNDNIEFLKEAKNLGKETAIYIPIESKEDEEFASEVARFGFVDNIILEGRD 113 +D IV + D++ L + L E I + +K DEE A+ AR + ++LE R Sbjct: 24 VDGIIVPRAQVDSVATLARCRVLADEDVATIALSAKADEEEAA--ARLARGETVVLE-RG 80 Query: 114 WTIIPLENLIADLFHRDVKIVASVNSVDEAKVAYEILEKGTDGVLLNPKNLEDIKELSKL 173 W IIP+ENL+A + + V + EA++A ILE+G V++ P E EL + Sbjct: 81 WEIIPVENLLA----QSDDVAVEVADLSEARLAAGILERGVATVVVLP---EGAGELKSI 133 Query: 174 IEEMNKEKVALDVA--TVTKVEPIGSGDRVCIDTCSLMKIGEGMLIGSYSRALFLVHSET 231 + ++ + +D+A VT VE +G G RVC+DT S+++ G+GML+G+ S FLVH+ET Sbjct: 134 VADLKLSQGCMDLAPAVVTAVENVGLGHRVCVDTMSMLRRGQGMLVGNSSAFTFLVHAET 193 Query: 232 VENPYVATRPFRVNAGPVHAYILCPGNKTKYLSELKAGDKVLIVDKDGNTREAIVGRVKI 291 N YVA RPFR+NAG VHAY PG++T YL EL+AGD+VLIV DG+T A VGR+K+ Sbjct: 194 EHNEYVAARPFRINAGAVHAYAQMPGDRTTYLEELRAGDEVLIVSADGSTTVATVGRLKM 253 Query: 292 ERRPLVLIEAEYKGDIIRTI-LQNAETIRLVNEKGEPISVVDLKPGDKVLIKPEEYARHF 350 E RP++L+ A+ GD+ + LQNAETIRL G P+SVV LK GD++L + + RHF Sbjct: 254 EARPMLLVRAKV-GDVEGAVFLQNAETIRLTRPDGTPVSVVSLKEGDQILCRTDCAGRHF 312 Query: 351 GMAIKETIIE 360 GM IKE I E Sbjct: 313 GMRIKEDIKE 322 Lambda K H 0.315 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 323 Length adjustment: 29 Effective length of query: 332 Effective length of database: 294 Effective search space: 97608 Effective search space used: 97608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory