Align Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 (uncharacterized)
to candidate 8501228 DvMF_1962 shikimate 5-dehydrogenase (RefSeq)
Query= curated2:Q30VD9 (279 letters) >lcl|FitnessBrowser__Miya:8501228 DvMF_1962 shikimate 5-dehydrogenase (RefSeq) Length = 315 Score = 290 bits (743), Expect = 2e-83 Identities = 158/292 (54%), Positives = 191/292 (65%), Gaps = 17/292 (5%) Query: 4 PRIPRQLYGIIGYPLGHSMSPLLHNWGFELLGEQAAYMAFPVAPEKLAEFICCARMLPVS 63 P +PR+LYGIIG+PLGH+MSPLLHNWGF LL A YMA+P+ P ++ +FI R LP+ Sbjct: 5 PFLPRELYGIIGHPLGHTMSPLLHNWGFSLLDVPAVYMAWPLEPGRVGDFITAVRTLPIR 64 Query: 64 GLSVTIPHKQAVMPLLDAVTPRAQAAGAVNTLFYDDGKLTGDNTDVYGFLHPL---DSCG 120 G SVTIPHKQAV+PLLD V+ RA+A GAVNTL++ DG+L G+NTDV GFL PL + G Sbjct: 65 GASVTIPHKQAVLPLLDGVSDRARAVGAVNTLYWRDGQLLGENTDVTGFLAPLRQRAAAG 124 Query: 121 TAHAAALVLGAGGAANAVLAALTARGMCN------VTVTNRNGDRARILAERFGVRCVAW 174 ALVLG GGAA AVLA L G V VT RN ++A LA FG V W Sbjct: 125 WRCERALVLGNGGAARAVLAGLRELGPAGDGVVRAVGVTGRNAEKAAPLAAEFGAEVVDW 184 Query: 175 EERHAVDADLVVNTTPLGMAGDRQAQTPLDPAFFSSRPA--------GLAYDLIYNPAQT 226 + R ADLVVNTTP+GM+G+RQ T F+++ GLAYDL+YNP +T Sbjct: 185 DARVHWGADLVVNTTPMGMSGERQGDTAFPEQGFAAQGVAAGGDGRRGLAYDLVYNPLRT 244 Query: 227 FFLASAQAAGWRVLNGLDMFVAQGAEQFRIWRGRELPFAQARALIADALASG 278 FL+ A AGW +GL MFV QG EQFR+W G ELP AR L+A AL G Sbjct: 245 RFLSEAADAGWDTQDGLGMFVEQGREQFRLWTGLELPAEGARTLVAVALGLG 296 Lambda K H 0.324 0.137 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 304 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 279 Length of database: 315 Length adjustment: 26 Effective length of query: 253 Effective length of database: 289 Effective search space: 73117 Effective search space used: 73117 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 48 (23.1 bits)
Align candidate 8501228 DvMF_1962 (shikimate 5-dehydrogenase (RefSeq))
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.31134.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.8e-64 201.1 0.0 1.3e-63 200.6 0.0 1.2 1 lcl|FitnessBrowser__Miya:8501228 DvMF_1962 shikimate 5-dehydrogen Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Miya:8501228 DvMF_1962 shikimate 5-dehydrogenase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 200.6 0.0 1.3e-63 1.3e-63 2 266 .. 11 290 .. 10 294 .. 0.86 Alignments for each domain: == domain 1 score: 200.6 bits; conditional E-value: 1.3e-63 TIGR00507 2 llgviGnpikhSksplihnaalkqlgleleYlafeveieelekalsgikalglkGvnvTvPfKeevlellDeieesa 78 l+g+iG+p h +spl+hn ++ l++ +Y+a ++e+ ++ ++++++++l+++G++vT+P+K++vl+llD ++++a lcl|FitnessBrowser__Miya:8501228 11 LYGIIGHPLGHTMSPLLHNWGFSLLDVPAVYMAWPLEPGRVGDFITAVRTLPIRGASVTIPHKQAVLPLLDGVSDRA 87 89*************************************************************************** PP TIGR00507 79 kligavNTlkledgklvgynTDgiGlvssLek.lsklksekrvliiGAGGaakavaleLlkad.......keviiaN 147 +++gavNTl +dg+l+g+nTD+ G+++ L++ +r+l++G GGaa+av+ L + + +v ++ lcl|FitnessBrowser__Miya:8501228 88 RAVGAVNTLYWRDGQLLGENTDVTGFLAPLRQrAAAGWRCERALVLGNGGAARAVLAGLRELGpagdgvvRAVGVTG 164 ********************************655545589****************99987522233334677889 PP TIGR00507 148 Rtvekaeelaerlqelgeilalsleevelkk.vdliinatsaglsgeid.eaevkaellkegk..........lvvD 212 R eka la ++ + e++ ++ + + dl++n+t++g+sge + +++ +++ ++++ l++D lcl|FitnessBrowser__Miya:8501228 165 RNAEKAAPLAAEFGA--EVVDWD---ARVHWgADLVVNTTPMGMSGERQgDTAFPEQGFAAQGvaaggdgrrgLAYD 236 998888888888877..666676...3334349**************9999999888776543111122222378** PP TIGR00507 213 lvynpletpllkeakkkgtkvidGlgMlvaQaalsFelwtgvepdvekvfealk 266 lvynpl t +l+ea + g ++dGlgM+v+Q+ +F+lwtg e + e ++ ++ lcl|FitnessBrowser__Miya:8501228 237 LVYNPLRTRFLSEAADAGWDTQDGLGMFVEQGREQFRLWTGLELPAEGARTLVA 290 ******************************************998888776665 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (315 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 9.99 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory