Align aspartate semialdehyde dehydrogenase subunit (EC 1.2.1.11) (characterized)
to candidate 8501664 DvMF_2382 aspartate-semialdehyde dehydrogenase (RefSeq)
Query= metacyc::MONOMER-6564 (346 letters) >FitnessBrowser__Miya:8501664 Length = 349 Score = 366 bits (939), Expect = e-106 Identities = 191/342 (55%), Positives = 248/342 (72%), Gaps = 8/342 (2%) Query: 5 LHVAVVGATGAVGQQMLKTLEDRNFEMDTLTLLSSKRSAGTKVTFKGQELTVQEASPESF 64 L VAV GATGAVG++ML TLE R F + +S RSAG KV F G ELTV+E + ESF Sbjct: 6 LVVAVCGATGAVGREMLNTLEQREFPAAEVIPFASARSAGNKVPFMGGELTVRELTEESF 65 Query: 65 EGVNIALFSAGGSVSQALAPEAVKRGAIVIDNTSAFRMDENTPLVVPEVNEADLHEHNGI 124 GV+IALFSAGGS S+ AP AV+ G +V+DN+SA+RMDE PLVVPEVN L HNGI Sbjct: 66 RGVDIALFSAGGSTSEKFAPHAVQAGCVVVDNSSAWRMDERCPLVVPEVNAHALAAHNGI 125 Query: 125 IANPNCSTIQMVAALEPIRKAYGLNKVIVSTYQAVSGAGNEAVKELYSQTQAILNKEEIE 184 IANPNCSTIQMV AL+P+ A + +V+VSTYQAVSG G +A+ EL Q + + N +E + Sbjct: 126 IANPNCSTIQMVVALKPLHDAARITRVVVSTYQAVSGTGQKAIDELEKQVRQMFNMQEPD 185 Query: 185 PEIMPVKGDKKHYQIAFNAIPQIDKFQDNGYTFEEMKMINETKKIMHMPDLQVAATCVRL 244 + P ++IAFN +PQID F DN YT EEMKM+ ET KIM P ++V ATCVR+ Sbjct: 186 VAVYP-------HRIAFNCLPQIDVFMDNDYTKEEMKMVLETVKIMEDPSVKVTATCVRV 238 Query: 245 PIQTGHSESVYIEIDRDDATVEDIKNLLKEAPGVTLQDDPSQQLYPMPADAVGKNDVFVG 304 P+ GHSESV IE +R + ++ + +L +APGV + D+P+Q++YPMP DA G++D FVG Sbjct: 239 PVFYGHSESVNIETER-KLSAKEARAILAQAPGVRVYDNPAQKMYPMPIDAAGEDDTFVG 297 Query: 305 RIRKDLDRANGFHLWVVSDNLLKGAAWNSVQIAESLKKLNLV 346 RIR+D ANG ++W+VSDN+ KGAA N+VQIAE+L + +L+ Sbjct: 298 RIREDETIANGLNMWIVSDNIRKGAALNAVQIAEALVERDLL 339 Lambda K H 0.314 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 346 Length of database: 349 Length adjustment: 29 Effective length of query: 317 Effective length of database: 320 Effective search space: 101440 Effective search space used: 101440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
Align candidate 8501664 DvMF_2382 (aspartate-semialdehyde dehydrogenase (RefSeq))
to HMM TIGR01296 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01296.hmm # target sequence database: /tmp/gapView.19845.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01296 [M=339] Accession: TIGR01296 Description: asd_B: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-152 491.0 0.8 1e-151 490.8 0.8 1.0 1 lcl|FitnessBrowser__Miya:8501664 DvMF_2382 aspartate-semialdehyde Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Miya:8501664 DvMF_2382 aspartate-semialdehyde dehydrogenase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 490.8 0.8 1e-151 1e-151 2 338 .. 8 335 .. 7 336 .. 0.99 Alignments for each domain: == domain 1 score: 490.8 bits; conditional E-value: 1e-151 TIGR01296 2 vaivGatGavGqellkvLeernfpidklvllasersaGkkvkfkgkeleveeaekesfegidialfsaGgsvskefa 78 va+ GatGavG+e+l++Le+r+fp+ +++++as+rsaG+kv f g el+v+e+++esf+g+dialfsaGgs+s++fa lcl|FitnessBrowser__Miya:8501664 8 VAVCGATGAVGREMLNTLEQREFPAAEVIPFASARSAGNKVPFMGGELTVRELTEESFRGVDIALFSAGGSTSEKFA 84 8**************************************************************************** PP TIGR01296 79 pkaakagviviDntsafrldedvPLvvpevnaeelkeakkkgiianPnCstiqlvvvLkplkdeaklkrvvvstYqa 155 p+a++ag++v+Dn+sa+r+de PLvvpevna+ l+ ++ giianPnCstiq+vv+Lkpl+d+a++ rvvvstYqa lcl|FitnessBrowser__Miya:8501664 85 PHAVQAGCVVVDNSSAWRMDERCPLVVPEVNAHALAAHN--GIIANPNCSTIQMVVALKPLHDAARITRVVVSTYQA 159 ***************************************..************************************ PP TIGR01296 156 vsGaGkkgveeLknqtkavlegkekepeidalkakkfakqiafnaiplidklkedGytkeelkllfetrkilgiedl 232 vsG+G+k+++eL++q++ +++++e ++ ++++iafn +p+id ++++ ytkee+k++ et ki++++ + lcl|FitnessBrowser__Miya:8501664 160 VSGTGQKAIDELEKQVRQMFNMQEPDV-------AVYPHRIAFNCLPQIDVFMDNDYTKEEMKMVLETVKIMEDPSV 229 ************************997.......78***************************************** PP TIGR01296 233 kvsatcvrvPvftghsesvsiefekelsveevkelLkeapgvvviddpsenlyptPleavgkdevfvgrirkDlske 309 kv+atcvrvPvf+ghsesv+ie+e++ls++e++ +L +apgv v d+p +++yp+P++a+g+d++fvgrir+D + + lcl|FitnessBrowser__Miya:8501664 230 KVTATCVRVPVFYGHSESVNIETERKLSAKEARAILAQAPGVRVYDNPAQKMYPMPIDAAGEDDTFVGRIREDETIA 306 ***************************************************************************** PP TIGR01296 310 kglalfvvaDnlrkGaalnavqiaellik 338 +gl++++v+Dn+rkGaalnavqiae+l++ lcl|FitnessBrowser__Miya:8501664 307 NGLNMWIVSDNIRKGAALNAVQIAEALVE 335 **************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (339 nodes) Target sequences: 1 (349 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 12.48 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory