Align Probable fructose-bisphosphate aldolase class 1; EC 4.1.2.13; Probable fructose-bisphosphate aldolase class I; FBP aldolase (uncharacterized)
to candidate 8501014 DvMF_1751 fructose-bisphosphate aldolase (RefSeq)
Query= curated2:Q9YG90 (272 letters) >FitnessBrowser__Miya:8501014 Length = 265 Score = 177 bits (448), Expect = 3e-49 Identities = 102/268 (38%), Positives = 154/268 (57%), Gaps = 8/268 (2%) Query: 7 VGKRVRLSRIL--PDGRSVIFAFDHGIEHGPGEIPEERLDPRLLIREVVEAGVDAIMTTP 64 +GKR+R+ RI GR+VI DHG+ GP +D R + +V E G DA++ Sbjct: 3 IGKRIRMERIFNRKTGRAVIVPLDHGVSVGP---IYGLVDMRETVNQVAEGGADAVLMHK 59 Query: 65 GIARLTWDIWANRVAMIIKVSGKTSIRPQDDQFLQSAISSVDEVVALGGDGVAATVYWGS 124 G+ R V +I+ +S TS+ P+ + ++ +++V++ + G DGV+ V G Sbjct: 60 GLVRCGHREGGRDVGLIVHLSASTSLSPRPNA--KTLVATVEDALKHGADGVSVHVNLGD 117 Query: 125 QFEDKMLERWTRIRLRAEKLGLPALQLAYPRGPHIKNRYAVDIVAYGARAAMETGADLIK 184 + E ML R+ A G+P L + Y RGP IKN Y ++VA+ AR +E GAD++K Sbjct: 118 ETERDMLADLGRVATVANDWGMPLLAMMYARGPRIKNEYDPEVVAHAARVGVELGADVVK 177 Query: 185 TYYTGSTESFRRVVSAAGGVPVLMSGGARTPSPQEFLHKVYSVMEAGGGGVVVGRNIFQA 244 YTG +SF VV A+ VPV+++GG + S + FL V+ + AG G+ VGRNIFQ Sbjct: 178 VAYTGDMDSFAHVV-ASCCVPVVIAGGPKLDSTRSFLQMVHDAVRAGAAGLSVGRNIFQH 236 Query: 245 GDIRAMVKAIRAIVHEGFDPEKASKLLG 272 A+VKA+R +VHE +D E+A L+G Sbjct: 237 ERTPALVKALRGLVHEDWDVEQAMALVG 264 Lambda K H 0.320 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 265 Length adjustment: 25 Effective length of query: 247 Effective length of database: 240 Effective search space: 59280 Effective search space used: 59280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory