Align cysteine synthase (EC 2.5.1.47) (characterized)
to candidate 8501944 DvMF_2658 cysteine synthase (RefSeq)
Query= BRENDA::P9WP55 (310 letters) >FitnessBrowser__Miya:8501944 Length = 310 Score = 368 bits (944), Expect = e-106 Identities = 187/310 (60%), Positives = 226/310 (72%) Query: 1 MSIAEDITQLIGRTPLVRLRRVTDGAVADIVAKLEFFNPANSVKDRIGVAMLQAAEQAGL 60 M IA D+T+L+GRTPLVRL RV++G A++VAKLEF NP SVKDRI +AM+ A + G Sbjct: 1 MEIARDMTELVGRTPLVRLNRVSEGCAAEVVAKLEFNNPCASVKDRIALAMIDGAMERGE 60 Query: 61 IKPDTIILEPTSGNTGIALAMVCAARGYRCVLTMPETMSLERRMLLRAYGAELILTPGAD 120 + P +++EPTSGNTG+ LA V A RG VLTMPE+MS ER+ LLR +GA L+LTP + Sbjct: 61 LAPGGLLVEPTSGNTGVGLAFVAAVRGLTLVLTMPESMSNERKALLRGFGARLVLTPASK 120 Query: 121 GMSGAIAKAEELAKTDQRYFVPQQFENPANPAIHRVTTAEEVWRDTDGKVDIVVAGVGTG 180 GM GAI +AE + + QF NP NP +HR TTAEE+W DTDGKVD VAGVGTG Sbjct: 121 GMRGAIEEAERIVAETPGAVMLGQFVNPDNPLVHRKTTAEEIWADTDGKVDAFVAGVGTG 180 Query: 181 GTITGVAQVIKERKPSARFVAVEPAASPVLSGGQKGPHPIQGIGAGFVPPVLDQDLVDEI 240 GT+TG + ++E P + AVEP SPVLSGG GPHPIQGIGAGFVPPVLD + DEI Sbjct: 181 GTVTGTGRRLRELNPDIKVFAVEPDESPVLSGGAPGPHPIQGIGAGFVPPVLDTKVYDEI 240 Query: 241 ITVGNEDALNVARRLAREEGLLVGISSGAATVAALQVARRPENAGKLIVVVLPDFGERYL 300 I V +DAL ARRL REEG+L G+SSGA AA+ VARRPE AGK +V V+ D GERYL Sbjct: 241 IRVPGKDALVTARRLLREEGILCGVSSGANAFAAMAVARRPEMAGKRVVFVVCDTGERYL 300 Query: 301 STPLFADVAD 310 STPLF ++ D Sbjct: 301 STPLFTEMPD 310 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 343 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 310 Length of database: 310 Length adjustment: 27 Effective length of query: 283 Effective length of database: 283 Effective search space: 80089 Effective search space used: 80089 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate 8501944 DvMF_2658 (cysteine synthase (RefSeq))
to HMM TIGR01139 (cysK: cysteine synthase A (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01139.hmm # target sequence database: /tmp/gapView.10525.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01139 [M=298] Accession: TIGR01139 Description: cysK: cysteine synthase A Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.3e-136 438.0 0.0 9.3e-136 437.9 0.0 1.0 1 lcl|FitnessBrowser__Miya:8501944 DvMF_2658 cysteine synthase (Ref Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Miya:8501944 DvMF_2658 cysteine synthase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 437.9 0.0 9.3e-136 9.3e-136 2 298 .] 8 305 .. 7 305 .. 0.99 Alignments for each domain: == domain 1 score: 437.9 bits; conditional E-value: 9.3e-136 TIGR01139 2 seliGntPlvrLn.laeeakaevlvkleslnPsssvkdrialamiedaekegllkkgktiveatsGntGialamvaa 77 +el+G+tPlvrLn + e+++aev++kle++nP++svkdrialami a ++g l +g +ve+tsGntG++la+vaa lcl|FitnessBrowser__Miya:8501944 8 TELVGRTPLVRLNrVSEGCAAEVVAKLEFNNPCASVKDRIALAMIDGAMERGELAPGGLLVEPTSGNTGVGLAFVAA 84 799**********999************************************************************* PP TIGR01139 78 argykliltmpetmslerrkllkayGaelvLtdgaegmkgaiekaeelveetpnkylllkqfenpanpeihrkttap 154 rg++l+ltmpe+ms er++ll+ +Ga+lvLt++++gm+gaie+ae +v+etp ++l qf np np +hrktta+ lcl|FitnessBrowser__Miya:8501944 85 VRGLTLVLTMPESMSNERKALLRGFGARLVLTPASKGMRGAIEEAERIVAETP-GAVMLGQFVNPDNPLVHRKTTAE 160 *****************************************************.556******************** PP TIGR01139 155 eilkdldgkldafvagvGtGGtitGvgevlkekkpdikvvavePaespvlsggkpgphkiqGigagfiPkvLdkevi 231 ei+ d+dgk+dafvagvGtGGt+tG+g+ l+e +pdikv+aveP espvlsgg pgph iqGigagf+P vLd++v+ lcl|FitnessBrowser__Miya:8501944 161 EIWADTDGKVDAFVAGVGTGGTVTGTGRRLRELNPDIKVFAVEPDESPVLSGGAPGPHPIQGIGAGFVPPVLDTKVY 237 ***************************************************************************** PP TIGR01139 232 devikvsdeeaietarrlakeeGilvGissGaavaaalkvakkle.kdkkivvilpdtgerYlstaLf 298 de+i+v +a+ tarrl +eeGil G+ssGa+ +aa+ va+++e ++k++v +++dtgerYlst+Lf lcl|FitnessBrowser__Miya:8501944 238 DEIIRVPGKDALVTARRLLREEGILCGVSSGANAFAAMAVARRPEmAGKRVVFVVCDTGERYLSTPLF 305 *********************************************9*********************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (310 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 11.30 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory