Align ATP phosphoribosyltransferase (EC 2.4.2.17) (characterized)
to candidate 8501229 DvMF_1963 ATP phosphoribosyltransferase (RefSeq)
Query= reanno::Miya:8501229 (293 letters) >FitnessBrowser__Miya:8501229 Length = 293 Score = 581 bits (1497), Expect = e-171 Identities = 293/293 (100%), Positives = 293/293 (100%) Query: 1 MSGNNMLKIGIPKGSLEEATVNLFARSGWKIRKHHRNYFPEINDPELTARLCRVQEIPRY 60 MSGNNMLKIGIPKGSLEEATVNLFARSGWKIRKHHRNYFPEINDPELTARLCRVQEIPRY Sbjct: 1 MSGNNMLKIGIPKGSLEEATVNLFARSGWKIRKHHRNYFPEINDPELTARLCRVQEIPRY 60 Query: 61 LEDGVLDVGLTGKDWLLETGADVVTVSDLVYSKVSNRPARWVLAVAGDSPYVRPEDLAGC 120 LEDGVLDVGLTGKDWLLETGADVVTVSDLVYSKVSNRPARWVLAVAGDSPYVRPEDLAGC Sbjct: 61 LEDGVLDVGLTGKDWLLETGADVVTVSDLVYSKVSNRPARWVLAVAGDSPYVRPEDLAGC 120 Query: 121 TIATELLGVTRRYFEDAGIPVKVQYSWGATEAKVVEGLADAIVEVTETGTTIKAHGLRII 180 TIATELLGVTRRYFEDAGIPVKVQYSWGATEAKVVEGLADAIVEVTETGTTIKAHGLRII Sbjct: 121 TIATELLGVTRRYFEDAGIPVKVQYSWGATEAKVVEGLADAIVEVTETGTTIKAHGLRII 180 Query: 181 AEVLLTNTVLIAGKAAWADPWKRAKIEQIDLLLQGALRADSLVGLKMNVPAHNLDAVLDQ 240 AEVLLTNTVLIAGKAAWADPWKRAKIEQIDLLLQGALRADSLVGLKMNVPAHNLDAVLDQ Sbjct: 181 AEVLLTNTVLIAGKAAWADPWKRAKIEQIDLLLQGALRADSLVGLKMNVPAHNLDAVLDQ 240 Query: 241 LPSLNSPTVAGLRDSTWYAVEIVVENDLVRDLIPRLRAAGAEGIIEYSLNKVI 293 LPSLNSPTVAGLRDSTWYAVEIVVENDLVRDLIPRLRAAGAEGIIEYSLNKVI Sbjct: 241 LPSLNSPTVAGLRDSTWYAVEIVVENDLVRDLIPRLRAAGAEGIIEYSLNKVI 293 Lambda K H 0.318 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 501 Number of extensions: 25 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 293 Length of database: 293 Length adjustment: 26 Effective length of query: 267 Effective length of database: 267 Effective search space: 71289 Effective search space used: 71289 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate 8501229 DvMF_1963 (ATP phosphoribosyltransferase (RefSeq))
to HMM TIGR00070 (hisG: ATP phosphoribosyltransferase (EC 2.4.2.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00070.hmm # target sequence database: /tmp/gapView.24326.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00070 [M=183] Accession: TIGR00070 Description: hisG: ATP phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-54 169.5 0.0 4.4e-54 169.2 0.0 1.1 1 lcl|FitnessBrowser__Miya:8501229 DvMF_1963 ATP phosphoribosyltran Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Miya:8501229 DvMF_1963 ATP phosphoribosyltransferase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 169.2 0.0 4.4e-54 4.4e-54 1 183 [] 7 192 .. 7 192 .. 0.98 Alignments for each domain: == domain 1 score: 169.2 bits; conditional E-value: 4.4e-54 TIGR00070 1 lriAlpKGrleeetlkllekaglklskkeerkliasaedeevevlllrakdiptyvekgaadlGitGkDlleEsead 77 l+i++pKG+lee t++l++++g+k++k++ r+++ +++d+e+++ l+r ++ip+y+e+g++d+G+tGkD+l E +ad lcl|FitnessBrowser__Miya:8501229 7 LKIGIPKGSLEEATVNLFARSGWKIRKHH-RNYFPEINDPELTARLCRVQEIPRYLEDGVLDVGLTGKDWLLETGAD 82 89***************************.*********************************************** PP TIGR00070 78 vvelldlgfgkc.....klvlAvpeesdvesledlkegkriATkypnltreylekkgvkveivkleGavElapllgl 149 vv++ dl ++k ++vlAv +s++ ++edl+ g iAT+ +tr+y+e+ g++v++ ++Ga+E++++ gl lcl|FitnessBrowser__Miya:8501229 83 VVTVSDLVYSKVsnrpaRWVLAVAGDSPYVRPEDLA-GCTIATELLGVTRRYFEDAGIPVKVQYSWGATEAKVVEGL 158 *******9988777777*******************.9*************************************** PP TIGR00070 150 adaIvDivetGttLrengLkiieeilessarlia 183 adaIv ++etGtt++++gL+ii+e+l ++++lia lcl|FitnessBrowser__Miya:8501229 159 ADAIVEVTETGTTIKAHGLRIIAEVLLTNTVLIA 192 ********************************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (183 nodes) Target sequences: 1 (293 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 12.22 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory