Align Histidinol-phosphatase; HolPase; EC 3.1.3.15; Histidinol-phosphate phosphatase (uncharacterized)
to candidate 8500294 DvMF_1050 Inositol-phosphate phosphatase (RefSeq)
Query= curated2:P56160 (259 letters) >FitnessBrowser__Miya:8500294 Length = 279 Score = 112 bits (280), Expect = 8e-30 Identities = 84/248 (33%), Positives = 115/248 (46%), Gaps = 9/248 (3%) Query: 5 LQLALELAEKAGKLTLDYFGRRSLQV--FSKRDDTPVTEADRNAEELIRQGISAKFPDDG 62 L +AL+ A KAG L R +V +K TE D +E I I +PD Sbjct: 22 LAVALDAA-KAGCAVLARGRSRLARVRTTTKSPGDITTELDARSEAAIFARIRQAYPDHA 80 Query: 63 LFGEEFDEHPSGNGR---RWIIDPIDGTRSFIHGVPLYGVMIALEVEGAMQLGVINFPAL 119 GEE + +G RWI+DP+DGT +++HG+P Y V +ALEV G LGV+ P Sbjct: 81 RLGEESGDSTGDSGASPFRWIVDPLDGTVNYVHGIPYYAVSVALEVNGVAVLGVVADPGR 140 Query: 120 GELYQAERGSGAFMNGSPVQV---SAIAENSASTVVFTEKEYLLDPPSNHPVDQLRIDAG 176 E + A RG GAF NG PV V + + E TVV K ++ R AG Sbjct: 141 REFFTAVRGQGAFCNGRPVHVARRTRMDEAVVGTVVPPPKWPGMEGYLEQFCAVARCAAG 200 Query: 177 LVRGWGDCYGHMLVASGRAEVAVDKIMSPWDCAAVIPIVEEAGGCCFDYRGRQSIIDGEG 236 + RG VA+GR + + WD +A +V EAGG D G + Sbjct: 201 MRRGGAAALDLAYVAAGRLDGFFVVSLKRWDLSAGALLVREAGGAVADIDGHPDPLHANR 260 Query: 237 LVSANNAM 244 L +AN+ + Sbjct: 261 LAAANSTL 268 Lambda K H 0.319 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 279 Length adjustment: 25 Effective length of query: 234 Effective length of database: 254 Effective search space: 59436 Effective search space used: 59436 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory