Align Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 (characterized)
to candidate 8499722 DvMF_0487 ribose-phosphate pyrophosphokinase (RefSeq)
Query= SwissProt::P0A1V6 (315 letters) >FitnessBrowser__Miya:8499722 Length = 312 Score = 334 bits (857), Expect = 1e-96 Identities = 167/311 (53%), Positives = 226/311 (72%), Gaps = 3/311 (0%) Query: 3 DMKLFAGNATPELAQRIANRLYTSLGDAAVGRFSDGEVSVQINENVRGGDIFIIQSTCAP 62 D+K+ G + P LA+ I N L L A FSDGE+ ++I +NVRG D+F++Q+TC+P Sbjct: 4 DLKILTGTSNPALAKAICNHLGCQLTPALCETFSDGEIRIEIGDNVRGDDVFVVQATCSP 63 Query: 63 TNDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSVGV 122 N NLM+L +M+DAL+RASAGR+TAV+PY+GYARQDR+V S R PI+AK+VADFL++ G Sbjct: 64 VNYNLMQLCLMLDALKRASAGRVTAVVPYYGYARQDRKV-SPRAPISAKLVADFLTTAGT 122 Query: 123 DRVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDMLQLNLDNPIVVSPDIGGVVRARAIAK 182 DRV+TVDLHA QIQGFF+VPVDN++ P++LE L+ + ++VSPD GGV RAR+ AK Sbjct: 123 DRVVTVDLHAGQIQGFFNVPVDNLYAQPVILE-YLRPYAGDIVIVSPDAGGVERARSFAK 181 Query: 183 LLNDTDMAIIDKRRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAK 242 LN +AIIDKRR R N + MH+IGDV + ++VDDMIDT GT+C A E L + GAK Sbjct: 182 KLN-AGLAIIDKRRDRPNQASAMHVIGDVRDKIAIVVDDMIDTAGTMCAAGEVLLKNGAK 240 Query: 243 RVFAYATHPIFSGNAANNLRNSVIDEVVVCDTIPLTDEIKALPNVRTLTLSGMLAEAIRR 302 V A ATHP+ SG A L NS +V+V DT+PL D++ A ++ L+++G+LA+AI Sbjct: 241 EVMACATHPVLSGPAIERLCNSTFSQVIVTDTVPLGDKLAACSKLKVLSVAGLLAKAIHN 300 Query: 303 ISNEESISAMF 313 I E S+S +F Sbjct: 301 IHTESSVSVLF 311 Lambda K H 0.322 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 296 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 315 Length of database: 312 Length adjustment: 27 Effective length of query: 288 Effective length of database: 285 Effective search space: 82080 Effective search space used: 82080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate 8499722 DvMF_0487 (ribose-phosphate pyrophosphokinase (RefSeq))
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01251.hmm # target sequence database: /tmp/gapView.10308.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01251 [M=309] Accession: TIGR01251 Description: ribP_PPkin: ribose-phosphate diphosphokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-125 404.0 0.0 1.9e-125 403.9 0.0 1.0 1 lcl|FitnessBrowser__Miya:8499722 DvMF_0487 ribose-phosphate pyrop Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Miya:8499722 DvMF_0487 ribose-phosphate pyrophosphokinase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 403.9 0.0 1.9e-125 1.9e-125 2 308 .. 6 311 .. 5 312 .] 0.99 Alignments for each domain: == domain 1 score: 403.9 bits; conditional E-value: 1.9e-125 TIGR01251 2 kilsgssskelaekvaknlglelgdvevkkFadgElyvrieesvrgkdvfiivqstsapvndalmellllidalkra 78 kil g+s+++la++++++lg +l+++ ++F+dgE+ ++i ++vrg dvf++ q t+ pvn +lm+l l++dalkra lcl|FitnessBrowser__Miya:8499722 6 KILTGTSNPALAKAICNHLGCQLTPALCETFSDGEIRIEIGDNVRGDDVFVV-QATCSPVNYNLMQLCLMLDALKRA 81 899*******************************************999999.99999******************* PP TIGR01251 79 saksvtaviPyygYaRqdkkaksrepisaklvaklleeaGadrvltvdlHseqiqgfFdvpvenlsaspklieelkk 155 sa++vtav+PyygYaRqd+k+++r pisaklva++l++aG+drv+tvdlH+ qiqgfF+vpv+nl+a+p+++e+l+ lcl|FitnessBrowser__Miya:8499722 82 SAGRVTAVVPYYGYARQDRKVSPRAPISAKLVADFLTTAGTDRVVTVDLHAGQIQGFFNVPVDNLYAQPVILEYLRP 158 ****************************************************************************8 PP TIGR01251 156 kelknlvvvsPDkGaverakkvakklglelaiieKeRdskenevevtnllgdvegkdvvivDDiisTggTlvkaael 232 ++ ++v+vsPD+G+vera+++akkl++ laii+K+Rd + n+++ ++++gdv +k +++vDD+i+T+gT+++a e+ lcl|FitnessBrowser__Miya:8499722 159 -YAGDIVIVSPDAGGVERARSFAKKLNAGLAIIDKRRD-RPNQASAMHVIGDVRDKIAIVVDDMIDTAGTMCAAGEV 233 .59***********************************.999*********************************** PP TIGR01251 233 LkekGAkkvivaathgvfsgdAlerlaeagveevivtntilv.ee.kklpkvseisvapliaeaiarihenesvssl 307 L ++GAk+v+++ath+v+sg+A+erl ++++++vivt+t++ ++ +++k++++sva l+a+ai +ih+++svs l lcl|FitnessBrowser__Miya:8499722 234 LLKNGAKEVMACATHPVLSGPAIERLCNSTFSQVIVTDTVPLgDKlAACSKLKVLSVAGLLAKAIHNIHTESSVSVL 310 ******************************************9889******************************9 PP TIGR01251 308 f 308 f lcl|FitnessBrowser__Miya:8499722 311 F 311 9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (312 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.48 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory