GapMind for Amino acid biosynthesis

 

Aligments for a candidate for leuC in Desulfovibrio vulgaris Miyazaki F

Align 3-isopropylmalate dehydratase large subunit; EC 4.2.1.33 (characterized, see rationale)
to candidate 8501056 DvMF_1792 3-isopropylmalate dehydratase large subunit (RefSeq)

Query= uniprot:LEUC_DESVH
         (419 letters)



>lcl|FitnessBrowser__Miya:8501056 DvMF_1792 3-isopropylmalate
           dehydratase large subunit (RefSeq)
          Length = 418

 Score =  724 bits (1870), Expect = 0.0
 Identities = 359/419 (85%), Positives = 385/419 (91%), Gaps = 1/419 (0%)

Query: 1   MAHTLAQKILQRHTDEAITDAGQIVRCRVSMVLANDITAPLAIKSFRAMGAKRVFDKDRV 60
           MAHTLAQKILQ HTDEAIT AGQIVRCRVS+ LANDITAPLAIKSFRAMGAK+VFD+D+V
Sbjct: 1   MAHTLAQKILQAHTDEAITAAGQIVRCRVSLALANDITAPLAIKSFRAMGAKKVFDRDKV 60

Query: 61  ALVMDHFTPQKDIEAAQQVKLTREFAREMGVTHYYEGGDCGVEHALLPELGLVGPGDVVV 120
           ALVMDHFTPQKDI +AQQVKLTREFAREMGVTHYYEGGDCGVEHALLPELGLVGPGDVVV
Sbjct: 61  ALVMDHFTPQKDIASAQQVKLTREFAREMGVTHYYEGGDCGVEHALLPELGLVGPGDVVV 120

Query: 121 GADSHTCTYGGLGAFATGLGSTDVAGAMALGETWFKVPPTIRATFTGTLPAYVGAKDLIL 180
           GADSHTCTYGGLGAFATG GSTDVAGAMALGETWFKVPPTIRATFTGTLP +VGAKDLIL
Sbjct: 121 GADSHTCTYGGLGAFATGFGSTDVAGAMALGETWFKVPPTIRATFTGTLPKWVGAKDLIL 180

Query: 181 TLIGAIGVDGALYRALEFDGAAIEALDVEGRMTMANMAIEAGGKAGLFAADAKTLTYCTT 240
            LIG IGVDGALYRALEFDGAAIEAL VEGRMT+ANMAIEAGGKAGLFAADAKTL Y   
Sbjct: 181 RLIGEIGVDGALYRALEFDGAAIEALSVEGRMTIANMAIEAGGKAGLFAADAKTLAYTAA 240

Query: 241 AGRTGDTAFSADAGAVYERELSFDVTGMTPVVACPHLPDNVKPVSEVKDVTVQQVVIGSC 300
            GR  D   SAD GA YEREL+FDV+GM P+VACPHLP+NVKPV EV+ VT+ QVVIGSC
Sbjct: 241 RGRK-DAPLSADPGATYERELTFDVSGMEPLVACPHLPENVKPVGEVRGVTLDQVVIGSC 299

Query: 301 TNGRIGDLREAAAVLRGRKVSRDVRCIVLPATPGIWRQALREGLIETFMEAGCIVGPATC 360
           TNGRI D+REAA VL+GRKV++ VRCIVLPATPG+W++AL+EGLIETFME+GCIVGPATC
Sbjct: 300 TNGRISDMREAAEVLKGRKVAKGVRCIVLPATPGVWKEALKEGLIETFMESGCIVGPATC 359

Query: 361 GPCLGGHMGILADGERAIATTNRNFKGRMGSLESEVYLSGPATAAASAVTGVITDPSTL 419
           GPCLGGHMGILADGERAIATTNRNF+GRMGSLESEVYL+ PA AAASAV G+I  P +L
Sbjct: 360 GPCLGGHMGILADGERAIATTNRNFRGRMGSLESEVYLASPAVAAASAVAGIIAHPGSL 418


Lambda     K      H
   0.320    0.136    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 718
Number of extensions: 23
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 419
Length of database: 418
Length adjustment: 32
Effective length of query: 387
Effective length of database: 386
Effective search space:   149382
Effective search space used:   149382
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

Align candidate 8501056 DvMF_1792 (3-isopropylmalate dehydratase large subunit (RefSeq))
to HMM TIGR02083 (leuC: 3-isopropylmalate dehydratase, large subunit (EC 4.2.1.33))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR02083.hmm
# target sequence database:        /tmp/gapView.18313.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02083  [M=419]
Accession:   TIGR02083
Description: LEU2: 3-isopropylmalate dehydratase, large subunit
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
   9.8e-193  626.7   0.1   1.1e-192  626.4   0.1    1.0  1  lcl|FitnessBrowser__Miya:8501056  DvMF_1792 3-isopropylmalate dehy


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Miya:8501056  DvMF_1792 3-isopropylmalate dehydratase large subunit (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  626.4   0.1  1.1e-192  1.1e-192       2     417 ..       4     416 ..       3     418 .] 0.99

  Alignments for each domain:
  == domain 1  score: 626.4 bits;  conditional E-value: 1.1e-192
                         TIGR02083   2 tlaekiladkagkeevkpgelilakldlvlgndvttplaikafkelgvkkvfdkdkvalvldhftpnkdikaaeqvk 78 
                                       tla+kil  ++      +g+++  ++ l+l+nd+t+plaik+f+ +g+kkvfd+dkvalv+dhftp+kdi +a+qvk
  lcl|FitnessBrowser__Miya:8501056   4 TLAQKILQAHTDEAITAAGQIVRCRVSLALANDITAPLAIKSFRAMGAKKVFDRDKVALVMDHFTPQKDIASAQQVK 80 
                                       89*************************************************************************** PP

                         TIGR02083  79 lirefakekeiekyfeigelgvehallpekglvvsgdliigadshtctygalgafatgvgstdlavamatgkawfkv 155
                                       l+refa+e ++ +y+e g+ gvehallpe glv +gd+++gadshtctyg lgafatg gstd+a+ama g++wfkv
  lcl|FitnessBrowser__Miya:8501056  81 LTREFAREMGVTHYYEGGDCGVEHALLPELGLVGPGDVVVGADSHTCTYGGLGAFATGFGSTDVAGAMALGETWFKV 157
                                       ***************************************************************************** PP

                         TIGR02083 156 peaikfvlkgklkdyvsakdlilkiigkigvdgalykslefsgeglkelsvddrltianmaieagaktgifevdekt 232
                                       p +i+ ++ g l ++v akdlil++ig+igvdgaly++lef g +++ lsv++r+tianmaieag+k+g+f +d kt
  lcl|FitnessBrowser__Miya:8501056 158 PPTIRATFTGTLPKWVGAKDLILRLIGEIGVDGALYRALEFDGAAIEALSVEGRMTIANMAIEAGGKAGLFAADAKT 234
                                       ***************************************************************************** PP

                         TIGR02083 233 ieyvkgrakrelkiykadedakyervieidlselepqvafphlpentkeideaekeeikidqvvigsctngrledlr 309
                                       ++y+  r++++  + +ad  a yer++ +d+s +ep va phlpen k++ e+    + +dqvvigsctngr++d+r
  lcl|FitnessBrowser__Miya:8501056 235 LAYTAARGRKDAPL-SADPGATYERELTFDVSGMEPLVACPHLPENVKPVGEVR--GVTLDQVVIGSCTNGRISDMR 308
                                       ********999875.67************************************9..9******************** PP

                         TIGR02083 310 laaeilkgkkvakevrliilpasqkvylealkeglleifieagavvstptcgpclgghmgilaegeravsttnrnfv 386
                                        aae+lkg+kvak vr+i+lpa++ v++ealkegl+e+f+e+g++v++ tcgpclgghmgila+gera++ttnrnf 
  lcl|FitnessBrowser__Miya:8501056 309 EAAEVLKGRKVAKGVRCIVLPATPGVWKEALKEGLIETFMESGCIVGPATCGPCLGGHMGILADGERAIATTNRNFR 385
                                       ***************************************************************************** PP

                         TIGR02083 387 grmghpksevylaspavaaasaikgkiaspe 417
                                       grmg  +sevylaspavaaasa++g+ia+p 
  lcl|FitnessBrowser__Miya:8501056 386 GRMGSLESEVYLASPAVAAASAVAGIIAHPG 416
                                       ****************************996 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (419 nodes)
Target sequences:                          1  (418 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 10.25
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory