Align 2-oxoacid oxidoreductase (ferredoxin) (subunit 1/2) (EC 1.2.7.11) (characterized)
to candidate 8499412 DvMF_0185 pyruvate ferredoxin/flavodoxin oxidoreductase, beta subunit (RefSeq)
Query= BRENDA::Q4J6I8 (303 letters) >FitnessBrowser__Miya:8499412 Length = 283 Score = 219 bits (557), Expect = 8e-62 Identities = 117/280 (41%), Positives = 172/280 (61%), Gaps = 18/280 (6%) Query: 10 WCPGCGNFGILRAEEMAIQELGVDFKKVVLVSGIGCSGKMPHFVNLPVGGVHTLHGRALA 69 WCPGCGN +++A A+ L + +V VSGIG + K PH+++L G + LHGR L Sbjct: 14 WCPGCGNHDVMKAVRQALAGLDLAPNRVAHVSGIGQAAKAPHYIDL--NGFNGLHGRGLP 71 Query: 70 FATGIKLANPSLEVIVNVGDGDGLGIGMGHFVHLGRRNIDITLIVHDNGVYGLTKGQAAP 129 A IKL NP L VI GDG G G HF+ RRN+D+TL+VHDN +YGLTKGQA+P Sbjct: 72 PAQAIKLCNPELTVIAQSGDGCNYGEGGNHFLAAIRRNVDMTLLVHDNQIYGLTKGQASP 131 Query: 130 TLERGIKTKSLPKPNINDAVNPLAVALSAGYTFIARAYAYDVIHLKEVIKRAIKHKGSAI 189 T G TKS P N NP+AVA++ +F+AR+++ + HL ++I+ AI+HKG A+ Sbjct: 132 TTPEGQITKSQPDGVRNAPFNPIAVAVAMKCSFVARSFSGNTPHLVKMIQLAIQHKGFAL 191 Query: 190 IDVFQPCPTYNDINTKEWYDKRVYKLDKDPTWDPVVRKEEEKQSKFEKALLKSMEFGEKI 249 +D+F PC ++N +NT WY +R +L +D +DP + + A+ + EFGE+I Sbjct: 192 VDLFSPCVSFNKVNTFGWYKQRCQELPED--YDP---------TDWAAAMQVAQEFGERI 240 Query: 250 PIGVFYENELVPTFEERLESNIPNYREFHPAAQPIEIDGI 289 PIGV Y N+ L++++P ++ QP++ DG+ Sbjct: 241 PIGVIYRND-----RPSLDASLPVLQKGPLGRQPVDRDGL 275 Lambda K H 0.320 0.140 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 283 Length adjustment: 26 Effective length of query: 277 Effective length of database: 257 Effective search space: 71189 Effective search space used: 71189 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory